Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	221458
Gene name	Kinesin family member 6
Gene symbol	KIF6
Synonyms (NCBI Gene)	C6orf102dJ1043E3.1dJ137F1.4dJ188D3.1
Chromosome	6
Chromosome location	6p21.2
Summary	This gene encodes a member of a family of molecular motors which are involved in intracellular transport of protein complexes, membrane organelles, and messenger ribonucleic acid along microtubules. Kinesins function as homodimeric molecules with two N-te

213

Show/Hide all (213)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045765	hsa-miR-125a-5p	CLASH	23622248
MIRT042748	hsa-miR-339-5p	CLASH	23622248
MIRT725408	hsa-miR-3133	HITS-CLIP	19536157
MIRT725407	hsa-miR-186-5p	HITS-CLIP	19536157
MIRT725406	hsa-miR-4310	HITS-CLIP	19536157
MIRT725405	hsa-miR-7157-5p	HITS-CLIP	19536157
MIRT719172	hsa-miR-3943	HITS-CLIP	19536157
MIRT719171	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT719170	hsa-miR-203b-5p	HITS-CLIP	19536157
MIRT719169	hsa-miR-6718-5p	HITS-CLIP	19536157
MIRT719168	hsa-miR-6798-5p	HITS-CLIP	19536157
MIRT719167	hsa-miR-345-3p	HITS-CLIP	19536157
MIRT719166	hsa-miR-4313	HITS-CLIP	19536157
MIRT719165	hsa-miR-671-5p	HITS-CLIP	19536157
MIRT725404	hsa-miR-504-3p	HITS-CLIP	19536157
MIRT725403	hsa-miR-122-5p	HITS-CLIP	19536157
MIRT719164	hsa-miR-4271	HITS-CLIP	19536157
MIRT719163	hsa-miR-4725-3p	HITS-CLIP	19536157
MIRT719162	hsa-miR-6780b-5p	HITS-CLIP	19536157
MIRT719161	hsa-miR-6801-5p	HITS-CLIP	19536157
MIRT719172	hsa-miR-3943	HITS-CLIP	19536157
MIRT719171	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT719170	hsa-miR-203b-5p	HITS-CLIP	19536157
MIRT719169	hsa-miR-6718-5p	HITS-CLIP	19536157
MIRT719168	hsa-miR-6798-5p	HITS-CLIP	19536157
MIRT719167	hsa-miR-345-3p	HITS-CLIP	19536157
MIRT719166	hsa-miR-4313	HITS-CLIP	19536157
MIRT719165	hsa-miR-671-5p	HITS-CLIP	19536157
MIRT719164	hsa-miR-4271	HITS-CLIP	19536157
MIRT719163	hsa-miR-4725-3p	HITS-CLIP	19536157
MIRT719162	hsa-miR-6780b-5p	HITS-CLIP	19536157
MIRT719161	hsa-miR-6801-5p	HITS-CLIP	19536157
MIRT518471	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT518470	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT518469	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT518468	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT518467	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT518466	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT518465	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT518464	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT518463	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT518462	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT518461	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT518460	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT518459	hsa-miR-302e	PAR-CLIP	23446348
MIRT518458	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT518457	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT518456	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT518455	hsa-miR-520b	PAR-CLIP	23446348
MIRT518454	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT518453	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT518452	hsa-miR-520e	PAR-CLIP	23446348
MIRT518451	hsa-miR-4433b-3p	PAR-CLIP	23446348
MIRT518450	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT518449	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT518447	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT518448	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT518446	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT447337	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT518445	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT518444	hsa-miR-4701-5p	PAR-CLIP	23446348
MIRT513280	hsa-miR-6760-5p	PAR-CLIP	23446348
MIRT513279	hsa-miR-6715a-3p	PAR-CLIP	23446348
MIRT513278	hsa-miR-6501-3p	PAR-CLIP	23446348
MIRT513277	hsa-miR-185-5p	PAR-CLIP	23446348
MIRT513276	hsa-miR-4306	PAR-CLIP	23446348
MIRT513275	hsa-miR-4644	PAR-CLIP	23446348
MIRT513274	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT513273	hsa-miR-8085	PAR-CLIP	23446348
MIRT498401	hsa-miR-21-3p	PAR-CLIP	22291592
MIRT498400	hsa-miR-3591-3p	PAR-CLIP	22291592
MIRT498399	hsa-miR-4464	PAR-CLIP	22291592
MIRT498398	hsa-miR-4748	PAR-CLIP	22291592
MIRT498397	hsa-miR-4772-5p	PAR-CLIP	22291592
MIRT498396	hsa-miR-5189-3p	PAR-CLIP	22291592
MIRT498395	hsa-miR-1254	PAR-CLIP	22291592
MIRT498394	hsa-miR-3116	PAR-CLIP	22291592
MIRT498393	hsa-miR-661	PAR-CLIP	22291592
MIRT498392	hsa-miR-192-3p	PAR-CLIP	22291592
MIRT498391	hsa-miR-4776-3p	PAR-CLIP	22291592
MIRT447352	hsa-miR-3929	PAR-CLIP	22100165
MIRT447351	hsa-miR-4419b	PAR-CLIP	22100165
MIRT447350	hsa-miR-4478	PAR-CLIP	22100165
MIRT447349	hsa-miR-889-5p	PAR-CLIP	22100165
MIRT447348	hsa-miR-135a-5p	PAR-CLIP	22100165
MIRT447347	hsa-miR-135b-5p	PAR-CLIP	22100165
MIRT447346	hsa-miR-1225-3p	PAR-CLIP	22100165
MIRT447345	hsa-miR-1233-3p	PAR-CLIP	22100165
MIRT447344	hsa-miR-485-5p	PAR-CLIP	22100165
MIRT447343	hsa-miR-6884-5p	PAR-CLIP	22100165
MIRT447342	hsa-miR-496	PAR-CLIP	22100165
MIRT447341	hsa-miR-8077	PAR-CLIP	22100165
MIRT447340	hsa-miR-3612	PAR-CLIP	22100165
MIRT447339	hsa-miR-650	PAR-CLIP	22100165
MIRT447337	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT447338	hsa-miR-4443	PAR-CLIP	22100165
MIRT447336	hsa-miR-6515-5p	PAR-CLIP	22100165
MIRT725408	hsa-miR-3133	HITS-CLIP	19536157
MIRT725407	hsa-miR-186-5p	HITS-CLIP	19536157
MIRT725406	hsa-miR-4310	HITS-CLIP	19536157
MIRT725405	hsa-miR-7157-5p	HITS-CLIP	19536157
MIRT719172	hsa-miR-3943	HITS-CLIP	19536157
MIRT719171	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT719170	hsa-miR-203b-5p	HITS-CLIP	19536157
MIRT719169	hsa-miR-6718-5p	HITS-CLIP	19536157
MIRT719168	hsa-miR-6798-5p	HITS-CLIP	19536157
MIRT719167	hsa-miR-345-3p	HITS-CLIP	19536157
MIRT719166	hsa-miR-4313	HITS-CLIP	19536157
MIRT719165	hsa-miR-671-5p	HITS-CLIP	19536157
MIRT725404	hsa-miR-504-3p	HITS-CLIP	19536157
MIRT725403	hsa-miR-122-5p	HITS-CLIP	19536157
MIRT719164	hsa-miR-4271	HITS-CLIP	19536157
MIRT719163	hsa-miR-4725-3p	HITS-CLIP	19536157
MIRT719162	hsa-miR-6780b-5p	HITS-CLIP	19536157
MIRT719161	hsa-miR-6801-5p	HITS-CLIP	19536157
MIRT719172	hsa-miR-3943	HITS-CLIP	19536157
MIRT719171	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT719170	hsa-miR-203b-5p	HITS-CLIP	19536157
MIRT719169	hsa-miR-6718-5p	HITS-CLIP	19536157
MIRT719168	hsa-miR-6798-5p	HITS-CLIP	19536157
MIRT719167	hsa-miR-345-3p	HITS-CLIP	19536157
MIRT719166	hsa-miR-4313	HITS-CLIP	19536157
MIRT719165	hsa-miR-671-5p	HITS-CLIP	19536157
MIRT719164	hsa-miR-4271	HITS-CLIP	19536157
MIRT719163	hsa-miR-4725-3p	HITS-CLIP	19536157
MIRT719162	hsa-miR-6780b-5p	HITS-CLIP	19536157
MIRT719161	hsa-miR-6801-5p	HITS-CLIP	19536157
MIRT518471	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT518470	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT518469	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT518468	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT518467	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT518466	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT518465	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT518464	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT518463	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT518462	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT518461	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT518460	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT518459	hsa-miR-302e	PAR-CLIP	23446348
MIRT518458	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT518457	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT518456	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT518455	hsa-miR-520b	PAR-CLIP	23446348
MIRT518454	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT518453	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT518452	hsa-miR-520e	PAR-CLIP	23446348
MIRT518451	hsa-miR-4433b-3p	PAR-CLIP	23446348
MIRT518450	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT518449	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT518447	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT518448	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT518446	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT447337	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT518445	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT518444	hsa-miR-4701-5p	PAR-CLIP	23446348
MIRT513280	hsa-miR-6760-5p	PAR-CLIP	23446348
MIRT513279	hsa-miR-6715a-3p	PAR-CLIP	23446348
MIRT513278	hsa-miR-6501-3p	PAR-CLIP	23446348
MIRT513277	hsa-miR-185-5p	PAR-CLIP	23446348
MIRT513276	hsa-miR-4306	PAR-CLIP	23446348
MIRT513275	hsa-miR-4644	PAR-CLIP	23446348
MIRT513274	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT513273	hsa-miR-8085	PAR-CLIP	23446348
MIRT498401	hsa-miR-21-3p	PAR-CLIP	22291592
MIRT498400	hsa-miR-3591-3p	PAR-CLIP	22291592
MIRT498399	hsa-miR-4464	PAR-CLIP	22291592
MIRT498398	hsa-miR-4748	PAR-CLIP	22291592
MIRT498397	hsa-miR-4772-5p	PAR-CLIP	22291592
MIRT498396	hsa-miR-5189-3p	PAR-CLIP	22291592
MIRT498395	hsa-miR-1254	PAR-CLIP	22291592
MIRT498394	hsa-miR-3116	PAR-CLIP	22291592
MIRT498393	hsa-miR-661	PAR-CLIP	22291592
MIRT498392	hsa-miR-192-3p	PAR-CLIP	22291592
MIRT498391	hsa-miR-4776-3p	PAR-CLIP	22291592
MIRT447352	hsa-miR-3929	PAR-CLIP	22100165
MIRT447351	hsa-miR-4419b	PAR-CLIP	22100165
MIRT447350	hsa-miR-4478	PAR-CLIP	22100165
MIRT447349	hsa-miR-889-5p	PAR-CLIP	22100165
MIRT447348	hsa-miR-135a-5p	PAR-CLIP	22100165
MIRT447347	hsa-miR-135b-5p	PAR-CLIP	22100165
MIRT447346	hsa-miR-1225-3p	PAR-CLIP	22100165
MIRT447345	hsa-miR-1233-3p	PAR-CLIP	22100165
MIRT447344	hsa-miR-485-5p	PAR-CLIP	22100165
MIRT447343	hsa-miR-6884-5p	PAR-CLIP	22100165
MIRT447342	hsa-miR-496	PAR-CLIP	22100165
MIRT447341	hsa-miR-8077	PAR-CLIP	22100165
MIRT447340	hsa-miR-3612	PAR-CLIP	22100165
MIRT447339	hsa-miR-650	PAR-CLIP	22100165
MIRT447337	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT447338	hsa-miR-4443	PAR-CLIP	22100165
MIRT447336	hsa-miR-6515-5p	PAR-CLIP	22100165
MIRT1095118	hsa-miR-1265	CLIP-seq
MIRT1095119	hsa-miR-140-3p	CLIP-seq
MIRT1095120	hsa-miR-23a	CLIP-seq
MIRT1095121	hsa-miR-23b	CLIP-seq
MIRT1095122	hsa-miR-23c	CLIP-seq
MIRT1095123	hsa-miR-371-5p	CLIP-seq
MIRT1095124	hsa-miR-371b-5p	CLIP-seq
MIRT1095125	hsa-miR-4323	CLIP-seq
MIRT1095126	hsa-miR-4476	CLIP-seq
MIRT1095127	hsa-miR-4533	CLIP-seq
MIRT1095128	hsa-miR-4690-3p	CLIP-seq
MIRT1095129	hsa-miR-513c	CLIP-seq
MIRT1095130	hsa-miR-514b-5p	CLIP-seq
MIRT2025495	hsa-miR-3620	CLIP-seq
MIRT2025496	hsa-miR-4292	CLIP-seq
MIRT2025497	hsa-miR-4308	CLIP-seq
MIRT2025498	hsa-miR-4660	CLIP-seq
MIRT2025499	hsa-miR-767-3p	CLIP-seq
MIRT2683484	hsa-miR-1245	CLIP-seq
MIRT2683485	hsa-miR-298	CLIP-seq
MIRT2683486	hsa-miR-522	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003777	Function	Microtubule motor activity	IBA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 19060904
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA

MIM	HGNC	e!Ensembl
613919	21202	ENSG00000164627

Q6ZMV9

Protein name

Kinesin-like protein KIF6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	25 → 345	Kinesin motor domain	Domain

Sequence

MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKF
QRIFDQDANQETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGII
PRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHEASSLEDLPKVTILEDPDQ
NIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSAT
VRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNS
MMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPRLV
IKRLQKEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRK
VHHCFHHLKKLLNDKKILENNTVSSESKDQDCQEPLKEEEYRKLRDILKQRDNEINILVN
MLKKEKKKAQEALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKR
SSLLHKKIGMREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEAR
SKIGHLKEEITQRHIQQVALGISENMAVPLMPDQQEEKLRSQLEEEKRRYKTMFTRLKAL
KVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAVNSLDHTKPFLQTSDSQHEWS
QLLSNKSSGGWEVQDQGTGRFDVCDVNARKILPSPCPSPHSQKQSSTSTPLEDSIPKRPV
SSIPLTGDSQTDSDIIAFIKARQSILQKQCLGSN

Sequence length

814

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		COPI-dependent Golgi-to-ER retrograde traffic Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSECTION OF AORTA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOSPADIAS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIF6-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
pravastatin response - Efficacy	drug response	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMOOTH SURFACE DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (36)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	18222355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22914592, 36833179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	36833179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	36833179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18073581, 18222354, 21044781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18073581, 18222354, 21044781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18222354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	37895049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17975119, 21406102, 21435211, 26772723, 30304062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	17975119, 18222354, 21435211, 30304062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19752551, 22192511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	22914592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18222354, 21435211, 21810021, 23001387, 23236363, 25629058, 26443250, 28096762, 29304815		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	18222354, 20933357, 21435211, 21810021, 23001387, 23236363, 25629058, 26443250, 28096762, 29304815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23001387, 26997531, 29295555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18073581, 18222353, 18222354, 20886236, 21406102, 21435211, 25629058, 27091178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18222354, 20854963, 20886236, 21406102, 21435211, 21810021, 22192511, 23001387, 23236363, 25629058, 26443250, 28096762, 29304815		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	18510970		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dental caries of smooth surface	Dental caries	GWASCAT_DG	24556642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25629058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21871624, 25629058		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	Pubtator	29295555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Extravasation of Diagnostic and Therapeutic Materials	Extravasation of diagnostic and therapeutic materials	Pubtator	35342690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	29295555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	29295555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	37895049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	30475797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22914592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18222353, 18222354, 20927332, 21406102, 21435211, 23001387	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	18222354, 20886236, 20927332, 21406102, 21810021, 22192511, 23355886, 26443250, 28096762		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	18222354		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	21943003		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	29295555	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis, unspecified	Scoliosis	BEFREE	25283277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	19752551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

KIF6 (kinesin family member 6)