FCGR3A (Fc gamma receptor IIIa)

Gene

• Entrez ID: 2214
• Gene name: Fc gamma receptor IIIa
• Gene symbol: FCGR3A
• Synonyms (NCBI Gene): CD16, CD16-II, CD16A, FCG3, FCGR3, FCGRIII, FCR-10, FCRIII, FCRIIIA, FcGRIIIA, IGFR3, IMD20
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs396991	A>C,G,T	Likely-benign, drug-response	Intron variant, coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT993883	hsa-miR-1292	CLIP-seq
MIRT993884	hsa-miR-1294	CLIP-seq
MIRT993885	hsa-miR-1301	CLIP-seq
MIRT993886	hsa-miR-3126-5p	CLIP-seq
MIRT993887	hsa-miR-4316	CLIP-seq
MIRT993888	hsa-miR-4419a	CLIP-seq
MIRT993889	hsa-miR-4510	CLIP-seq
MIRT993890	hsa-miR-4660	CLIP-seq
MIRT993891	hsa-miR-4677-3p	CLIP-seq
MIRT993892	hsa-miR-4738-3p	CLIP-seq
MIRT993893	hsa-miR-5047	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001788	Process	Antibody-dependent cellular cytotoxicity	IBA
GO:0001788	Process	Antibody-dependent cellular cytotoxicity	IDA	11711607, 27670158, 28652325
GO:0001913	Process	T cell mediated cytotoxicity	ISS
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	2532305, 23006327, 23024279, 33961781, 34158475
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	24337742
GO:0005886	Component	Plasma membrane	IDA	1825220, 2532305, 23006327, 24337742, 27670158, 28652325
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2138330
GO:0006955	Process	Immune response	TAS	2138330
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	10706735, 24942581
GO:0016020	Component	Membrane	IEA
GO:0017038	Process	Protein import	IDA	20038786
GO:0019722	Process	Calcium-mediated signaling	IDA	23024279
GO:0019770	Function	IgG receptor activity	IBA
GO:0019772	Function	Low-affinity IgG receptor activity	IDA	11711607
GO:0019864	Function	IgG binding	IEA
GO:0030101	Process	Natural killer cell activation	IDA	9916693
GO:0030101	Process	Natural killer cell activation	IMP	23006327
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	10728755
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	9916693
GO:0033001	Component	Fc-gamma receptor III complex	IDA	1825220, 28652325
GO:0038094	Process	Fc-gamma receptor signaling pathway	IDA	8478617, 23024279
GO:0042116	Process	Macrophage activation	IDA	10728755
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	10318937, 23006327
GO:0043320	Process	Natural killer cell degranulation	IDA	25786175, 28652325
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23024279
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071806	Process	Protein transmembrane transport	IDA	20038786
GO:0140375	Function	Immune receptor activity	IDA	10318937
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IDA	20038786

Other IDs

• MIM: 146740
• HGNC: 3619
• e!Ensembl: ENSG00000203747

Protein

• UniProt ID: P08637
• Protein name: Low affinity immunoglobulin gamma Fc region receptor III-A (IgG Fc receptor III-A) (CD16-II) (CD16a antigen) (Fc-gamma RIII-alpha) (Fc-gamma RIII) (Fc-gamma RIIIa) (FcRIII) (FcRIIIa) (FcgammaRIIIA) (FcR-10) (IgG Fc receptor III-2) (CD antigen CD16a)
• Protein function: Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent
• PDB: 3AY4, 3SGJ, 3SGK, 3WN5, 5BW7, 5D6D, 5ML9, 5MN2, 5VU0, 5XJE, 5XJF, 5YC5, 7SEG, 7URU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	27 → 104	Immunoglobulin domain	Domain
  PF13895	Ig_2	108 → 190	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in natural killer cells (at protein level) (PubMed:2526846). Expressed in a subset of circulating monocytes (at protein level) (PubMed:27670158). {ECO:0000269|PubMed:2526846, ECO:0000269|PubMed:27670158}.
• Sequence:

  MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQW
  FHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE
  EDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKN
  VSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDW
  KDHKFKWRKDPQDK

• Sequence length: 254

Pathways

KEGG:

Phagosome
Osteoclast differentiation
Neutrophil extracellular trap formation
Natural killer cell mediated cytotoxicity
Fc gamma R-mediated phagocytosis
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Systemic lupus erythematosus

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
FCGR activation
Regulation of actin dynamics for phagocytic cup formation
Role of phospholipids in phagocytosis
FCGR3A-mediated IL10 synthesis
FCGR3A-mediated phagocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANTI-BASEMENT MEMBRANE GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal recessive primary immunodeficiency with defective spontaneous natural killer cell cytotoxicity	Uncertain significance	ClinVar CTD, ClinVar, Orphanet CTD, ClinVar, Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BEHCET SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 20	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYNEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA DUE TO PLATELET ALLOIMMUNIZATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations