Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	221391
Gene name	Opsin 5
Gene symbol	OPN5
Synonyms (NCBI Gene)	GPR136GRP136PGR12TMEM13
Chromosome	6
Chromosome location	6p12.3
Summary	Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. This opsin gene is expressed in the eye, brain, testes, and spinal cord. This gene belongs to the seven-exon subfamily of mammalian opsin genes that inc

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT550747	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT550745	hsa-miR-8485	PAR-CLIP	21572407
MIRT550746	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT550744	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT550743	hsa-miR-603	PAR-CLIP	21572407
MIRT550742	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT550741	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT550740	hsa-miR-3941	PAR-CLIP	21572407
MIRT550739	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT550738	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT550737	hsa-miR-3924	PAR-CLIP	21572407
MIRT504160	hsa-miR-136-3p	PAR-CLIP	22012620
MIRT504159	hsa-miR-3675-3p	PAR-CLIP	22012620
MIRT504158	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT504157	hsa-miR-1248	PAR-CLIP	22012620
MIRT504156	hsa-miR-4778-3p	PAR-CLIP	22012620
MIRT504155	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT504154	hsa-miR-623	PAR-CLIP	22012620
MIRT504153	hsa-miR-204-5p	PAR-CLIP	22012620
MIRT504152	hsa-miR-211-5p	PAR-CLIP	22012620
MIRT504151	hsa-miR-4684-5p	PAR-CLIP	22012620
MIRT504150	hsa-miR-4755-5p	PAR-CLIP	22012620
MIRT504149	hsa-miR-5006-3p	PAR-CLIP	22012620
MIRT504148	hsa-miR-6875-3p	PAR-CLIP	22012620
MIRT504160	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT504159	hsa-miR-3675-3p	PAR-CLIP	23446348
MIRT504158	hsa-miR-4714-3p	PAR-CLIP	23446348
MIRT504157	hsa-miR-1248	PAR-CLIP	23446348
MIRT504156	hsa-miR-4778-3p	PAR-CLIP	23446348
MIRT504155	hsa-miR-505-3p	PAR-CLIP	23446348
MIRT504151	hsa-miR-4684-5p	PAR-CLIP	23446348
MIRT504148	hsa-miR-6875-3p	PAR-CLIP	23446348
MIRT504160	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT504159	hsa-miR-3675-3p	PAR-CLIP	23446348
MIRT504158	hsa-miR-4714-3p	PAR-CLIP	23446348
MIRT504157	hsa-miR-1248	PAR-CLIP	23446348
MIRT504156	hsa-miR-4778-3p	PAR-CLIP	23446348
MIRT504155	hsa-miR-505-3p	PAR-CLIP	23446348
MIRT504154	hsa-miR-623	PAR-CLIP	23446348
MIRT504153	hsa-miR-204-5p	PAR-CLIP	23446348
MIRT504152	hsa-miR-211-5p	PAR-CLIP	23446348
MIRT504151	hsa-miR-4684-5p	PAR-CLIP	23446348
MIRT504150	hsa-miR-4755-5p	PAR-CLIP	23446348
MIRT504149	hsa-miR-5006-3p	PAR-CLIP	23446348
MIRT504148	hsa-miR-6875-3p	PAR-CLIP	23446348
MIRT550747	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT550745	hsa-miR-8485	PAR-CLIP	21572407
MIRT550746	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT550744	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT550743	hsa-miR-603	PAR-CLIP	21572407
MIRT550742	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT550741	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT550740	hsa-miR-3941	PAR-CLIP	21572407
MIRT550739	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT550738	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT550737	hsa-miR-3924	PAR-CLIP	21572407
MIRT504160	hsa-miR-136-3p	PAR-CLIP	22012620
MIRT504159	hsa-miR-3675-3p	PAR-CLIP	22012620
MIRT504158	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT504157	hsa-miR-1248	PAR-CLIP	22012620
MIRT504156	hsa-miR-4778-3p	PAR-CLIP	22012620
MIRT504155	hsa-miR-505-3p	PAR-CLIP	22012620
MIRT504154	hsa-miR-623	PAR-CLIP	22012620
MIRT504153	hsa-miR-204-5p	PAR-CLIP	22012620
MIRT504152	hsa-miR-211-5p	PAR-CLIP	22012620
MIRT504151	hsa-miR-4684-5p	PAR-CLIP	22012620
MIRT504150	hsa-miR-4755-5p	PAR-CLIP	22012620
MIRT504149	hsa-miR-5006-3p	PAR-CLIP	22012620
MIRT504148	hsa-miR-6875-3p	PAR-CLIP	22012620
MIRT504160	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT504159	hsa-miR-3675-3p	PAR-CLIP	23446348
MIRT504158	hsa-miR-4714-3p	PAR-CLIP	23446348
MIRT504157	hsa-miR-1248	PAR-CLIP	23446348
MIRT504156	hsa-miR-4778-3p	PAR-CLIP	23446348
MIRT504155	hsa-miR-505-3p	PAR-CLIP	23446348
MIRT504151	hsa-miR-4684-5p	PAR-CLIP	23446348
MIRT504148	hsa-miR-6875-3p	PAR-CLIP	23446348
MIRT504160	hsa-miR-136-3p	PAR-CLIP	23446348
MIRT504159	hsa-miR-3675-3p	PAR-CLIP	23446348
MIRT504158	hsa-miR-4714-3p	PAR-CLIP	23446348
MIRT504157	hsa-miR-1248	PAR-CLIP	23446348
MIRT504156	hsa-miR-4778-3p	PAR-CLIP	23446348
MIRT504155	hsa-miR-505-3p	PAR-CLIP	23446348
MIRT504154	hsa-miR-623	PAR-CLIP	23446348
MIRT504153	hsa-miR-204-5p	PAR-CLIP	23446348
MIRT504152	hsa-miR-211-5p	PAR-CLIP	23446348
MIRT504151	hsa-miR-4684-5p	PAR-CLIP	23446348
MIRT504150	hsa-miR-4755-5p	PAR-CLIP	23446348
MIRT504149	hsa-miR-5006-3p	PAR-CLIP	23446348
MIRT504148	hsa-miR-6875-3p	PAR-CLIP	23446348
MIRT1204430	hsa-miR-1205	CLIP-seq
MIRT1204431	hsa-miR-1265	CLIP-seq
MIRT1204432	hsa-miR-1286	CLIP-seq
MIRT1204433	hsa-miR-204	CLIP-seq
MIRT1204434	hsa-miR-211	CLIP-seq
MIRT1204435	hsa-miR-2355-5p	CLIP-seq
MIRT1204436	hsa-miR-3065-5p	CLIP-seq
MIRT1204437	hsa-miR-371b-5p	CLIP-seq
MIRT1204438	hsa-miR-412	CLIP-seq
MIRT1204439	hsa-miR-4282	CLIP-seq
MIRT1204440	hsa-miR-4287	CLIP-seq
MIRT1204441	hsa-miR-4418	CLIP-seq
MIRT1204442	hsa-miR-4469	CLIP-seq
MIRT1204443	hsa-miR-4685-3p	CLIP-seq
MIRT1204444	hsa-miR-4698	CLIP-seq
MIRT1204445	hsa-miR-4713-5p	CLIP-seq
MIRT1204446	hsa-miR-4720-3p	CLIP-seq
MIRT1204447	hsa-miR-4722-5p	CLIP-seq
MIRT1204448	hsa-miR-4775	CLIP-seq
MIRT1204449	hsa-miR-4804-3p	CLIP-seq
MIRT1204450	hsa-miR-509-3-5p	CLIP-seq
MIRT1204451	hsa-miR-509-5p	CLIP-seq
MIRT1204452	hsa-miR-513b	CLIP-seq
MIRT1204453	hsa-miR-518a-3p	CLIP-seq
MIRT1204454	hsa-miR-518b	CLIP-seq
MIRT1204455	hsa-miR-518c	CLIP-seq
MIRT1204456	hsa-miR-518d-3p	CLIP-seq
MIRT1204457	hsa-miR-518f	CLIP-seq
MIRT1204458	hsa-miR-590-3p	CLIP-seq
MIRT1204459	hsa-miR-888	CLIP-seq
MIRT2058994	hsa-miR-4802-3p	CLIP-seq
MIRT2287113	hsa-miR-1255a	CLIP-seq
MIRT2287114	hsa-miR-1255b	CLIP-seq
MIRT2287115	hsa-miR-1972	CLIP-seq
MIRT1204436	hsa-miR-3065-5p	CLIP-seq
MIRT2287116	hsa-miR-3119	CLIP-seq
MIRT2287117	hsa-miR-4457	CLIP-seq
MIRT2287118	hsa-miR-4650-5p	CLIP-seq
MIRT2287119	hsa-miR-4727-5p	CLIP-seq
MIRT2287120	hsa-miR-4731-3p	CLIP-seq
MIRT2287121	hsa-miR-4801	CLIP-seq
MIRT1204452	hsa-miR-513b	CLIP-seq
MIRT2455654	hsa-miR-153	CLIP-seq
MIRT2455655	hsa-miR-448	CLIP-seq
MIRT2455656	hsa-miR-548m	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001750	Component	Photoreceptor outer segment	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005502	Function	11-cis retinal binding	IEA
GO:0005502	Function	11-cis retinal binding	IMP	22043319
GO:0005737	Component	Cytoplasm	IDA	30168605
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	31380578, 31730232
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007601	Process	Visual perception	IEA
GO:0007602	Process	Phototransduction	IBA
GO:0007602	Process	Phototransduction	IEA
GO:0007602	Process	Phototransduction	ISS
GO:0007604	Process	Phototransduction, UV	IEA
GO:0007604	Process	Phototransduction, UV	IMP	22043319
GO:0008020	Function	G protein-coupled photoreceptor activity	IBA
GO:0008020	Function	G protein-coupled photoreceptor activity	IEA
GO:0008020	Function	G protein-coupled photoreceptor activity	ISS
GO:0009584	Process	Detection of visible light	IEA
GO:0009881	Function	Photoreceptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0071482	Process	Cellular response to light stimulus	IBA
GO:0071482	Process	Cellular response to light stimulus	IEA
GO:0071482	Process	Cellular response to light stimulus	ISS
GO:0071492	Process	Cellular response to UV-A	IDA	31380578
GO:1990384	Process	Hyaloid vascular plexus regression	IEA
GO:1990384	Process	Hyaloid vascular plexus regression	ISS

MIM	HGNC	e!Ensembl
609042	19992	ENSG00000124818

Q6U736

Protein name

Opsin-5 (G-protein coupled receptor 136) (G-protein coupled receptor PGR12) (Neuropsin) (Transmembrane protein 13)

Protein function

G-protein coupled receptor which selectively activates G(i) type G proteins via ultraviolet A (UVA) light-mediated activation in the retina (By similarity). Preferentially binds the chromophore 11-cis retinal and is a bistable protein that displ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	50 → 306	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain and retina and cell lines derived from neural retina. {ECO:0000269|PubMed:14623103}.

Sequence

MALNHTALPQDERLPHYLRDGDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSR
RKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGS
LITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFG
TSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRI
HSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAM
YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEWE

Sequence length

354

Interactions

View interactions

	Reactome
			G alpha (i) signalling events Opsins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
NEPHROTIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar Disorder	BEFREE	18354391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	LHGDN	18354391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16614108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11309326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	15082799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28267150, 28636578, 31477683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	31477683, 34715912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	20500798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28267150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	20500798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	20500798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17452979, 18549897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16614108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11309326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28267150, 28636578, 31477683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	18354391		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11309326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18354391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28267150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stress Disorders, Traumatic	Stress Disorder	BEFREE	27701413		★★★★★ ★☆☆☆☆ Found in Text Mining only

OPN5 (opsin 5)