Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	221357
Gene name	Glutathione S-transferase alpha 5
Gene symbol	GSTA5
Synonyms (NCBI Gene)	-
Chromosome	6
Chromosome location	6p12.2
Summary	The glutathione S-transferases (GST; EC 2.5.1.18) catalyze the conjugation of reduced glutathiones and a variety of electrophiles, including many known carcinogens and mutagens. The cytosolic GSTs belong to a large superfamily, with members located on dif

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004364	Function	Glutathione transferase activity	ISS
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	ISS
GO:0006805	Process	Xenobiotic metabolic process	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

MIM	HGNC	e!Ensembl
607605	19662	ENSG00000182793

Q7RTV2

Protein name

Glutathione S-transferase A5 (EC 2.5.1.18) (GST class-alpha member 5) (Glutathione S-transferase A5-5)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02798	GST_N	5 → 77	Glutathione S-transferase, N-terminal domain	Domain
PF14497	GST_C_3	100 → 201	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expression not detected.

Sequence

MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAK
TALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF

Sequence length

222

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Platinum drug resistance Pathways in cancer Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Glutathione conjugation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Hypertensive disease	Hypertension	CTD_human_DG	22228705		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

GSTA5 (glutathione S-transferase alpha 5)