Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	221303
Gene name	Family with sequence similarity 162 member B
Gene symbol	FAM162B
Synonyms (NCBI Gene)	C6orf189bA86F4.2
Chromosome	6
Chromosome location	6q22.1

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments
MIRT981500	hsa-miR-1271	CLIP-seq
MIRT981501	hsa-miR-140-5p	CLIP-seq
MIRT981502	hsa-miR-182	CLIP-seq
MIRT981503	hsa-miR-34a	CLIP-seq
MIRT981504	hsa-miR-34c-5p	CLIP-seq
MIRT981505	hsa-miR-3646	CLIP-seq
MIRT981506	hsa-miR-3662	CLIP-seq
MIRT981507	hsa-miR-409-5p	CLIP-seq
MIRT981508	hsa-miR-412	CLIP-seq
MIRT981509	hsa-miR-449a	CLIP-seq
MIRT981510	hsa-miR-449b	CLIP-seq
MIRT981511	hsa-miR-4738-3p	CLIP-seq
MIRT981512	hsa-miR-96	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5T6X4

Protein name

Protein FAM162B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06388	DUF1075	18 → 139	Protein of unknown function (DUF1075)	Family

Sequence

MLRAVGSLLRLGRGLTVRCGPGAPLEATRRPAPALPPRGLPCYSSGGAPSNSGPQGHGEI
HRVPTQRRPSQFDKKILLWTGRFKSMEEIPPRIPPEMIDTARNKARVKACYIMIGLTIIA
CFAVIVSAKRAVERHESLTSWNLAKKAKWREEAALAAQAKAK

Sequence length

162

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Neoplasms	Neoplasms	BEFREE	27058892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32529991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FAM162B (family with sequence similarity 162 member B)