FCGR2B (Fc gamma receptor IIb)

Gene

• Entrez ID: 2213
• Gene name: Fc gamma receptor IIb
• Gene symbol: FCGR2B
• Synonyms (NCBI Gene): CD32, CD32B, FCG2, FCGR2, FCGR2C, FcGRIIB, FcRII-c, FcgammaRIIb, IGFR2
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1050501	T>A,C	Risk-factor, protective	Genic downstream transcript variant, downstream transcript variant, coding sequence variant, missense variant
rs3219018	G>C	Risk-factor	Upstream transcript variant, intron variant, genic upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438477	hsa-miR-18a-5p	qRT-PCR, Western blot	24169826
MIRT438477	hsa-miR-18a-5p	qRT-PCR, Western blot	24169826
MIRT993861	hsa-miR-1183	CLIP-seq
MIRT993862	hsa-miR-194	CLIP-seq
MIRT993863	hsa-miR-4423-3p	CLIP-seq
MIRT993864	hsa-miR-4427	CLIP-seq
MIRT993865	hsa-miR-4724-5p	CLIP-seq
MIRT993866	hsa-miR-103a	CLIP-seq
MIRT993867	hsa-miR-107	CLIP-seq
MIRT993868	hsa-miR-1184	CLIP-seq
MIRT993869	hsa-miR-147	CLIP-seq
MIRT993862	hsa-miR-194	CLIP-seq
MIRT993870	hsa-miR-219-5p	CLIP-seq
MIRT993871	hsa-miR-339-5p	CLIP-seq
MIRT993872	hsa-miR-4287	CLIP-seq
MIRT993873	hsa-miR-4418	CLIP-seq
MIRT993863	hsa-miR-4423-3p	CLIP-seq
MIRT993864	hsa-miR-4427	CLIP-seq
MIRT993874	hsa-miR-4445	CLIP-seq
MIRT993875	hsa-miR-4469	CLIP-seq
MIRT993876	hsa-miR-4666-5p	CLIP-seq
MIRT993877	hsa-miR-4685-3p	CLIP-seq
MIRT993865	hsa-miR-4724-5p	CLIP-seq
MIRT993878	hsa-miR-4742-5p	CLIP-seq
MIRT993879	hsa-miR-4782-3p	CLIP-seq
MIRT993880	hsa-miR-508-3p	CLIP-seq
MIRT993881	hsa-miR-509-3-5p	CLIP-seq
MIRT993882	hsa-miR-509-5p	CLIP-seq
MIRT993863	hsa-miR-4423-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA4	Unknown	15153544
YY1	Unknown	15153544

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IPI	23921129
GO:0001540	Function	Amyloid-beta binding	TAS	26871627
GO:0001788	Process	Antibody-dependent cellular cytotoxicity	IBA
GO:0001811	Process	Negative regulation of type I hypersensitivity	ISS	26683154
GO:0001814	Process	Negative regulation of antibody-dependent cellular cytotoxicity	TAS	26683154
GO:0001818	Process	Negative regulation of cytokine production	TAS	26683154
GO:0002252	Process	Immune effector process	IDA	2142460
GO:0002266	Process	Follicular dendritic cell activation	TAS	26683154
GO:0002313	Process	Mature B cell differentiation involved in immune response	TAS	26683154
GO:0002316	Process	Follicular B cell differentiation	TAS	26683154
GO:0002436	Process	Immune complex clearance by monocytes and macrophages	TAS	26683154
GO:0002605	Process	Negative regulation of dendritic cell antigen processing and presentation	TAS	26683154
GO:0002622	Process	Regulation of B cell antigen processing and presentation	TAS	26683154
GO:0002638	Process	Negative regulation of immunoglobulin production	ISS	26683154
GO:0002682	Process	Regulation of immune system process	IEA
GO:0002819	Process	Regulation of adaptive immune response	TAS	26683154
GO:0002865	Process	Negative regulation of acute inflammatory response to antigenic stimulus	ISS	26683154
GO:0002922	Process	Positive regulation of humoral immune response	TAS	26683154
GO:0002924	Process	Negative regulation of humoral immune response mediated by circulating immunoglobulin	ISS	26683154
GO:0005515	Function	Protein binding	IPI	8577729, 9148918, 9603468, 10382761, 11567028, 17474147, 24642916, 32814053
GO:0005886	Component	Plasma membrane	IDA	2142460, 23921129
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	2139735
GO:0005886	Component	Plasma membrane	TAS
GO:0006898	Process	Receptor-mediated endocytosis	IDA	2142460
GO:0006909	Process	Phagocytosis	IDA	2142460
GO:0006911	Process	Phagocytosis, engulfment	ISS	26683154
GO:0006952	Process	Defense response	ISS	26683154
GO:0006954	Process	Inflammatory response	TAS	26683154
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009617	Process	Response to bacterium	ISS	26683154
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	ISS	26683154
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	ISS	26683154
GO:0019770	Function	IgG receptor activity	IBA
GO:0019772	Function	Low-affinity IgG receptor activity	IDA	2142460
GO:0019864	Function	IgG binding	IBA
GO:0019864	Function	IgG binding	IDA	2142460
GO:0019864	Function	IgG binding	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	ISS	26683154
GO:0021549	Process	Cerebellum development	ISS	26683154
GO:0030889	Process	Negative regulation of B cell proliferation	ISS	26683154
GO:0032693	Process	Negative regulation of interleukin-10 production	ISS	26683154
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IBA
GO:0038094	Process	Fc-gamma receptor signaling pathway	IDA	2142460
GO:0043031	Process	Negative regulation of macrophage activation	TAS	26683154
GO:0043197	Component	Dendritic spine	ISS	26683154
GO:0043318	Process	Negative regulation of cytotoxic T cell degranulation	TAS	26683154
GO:0044297	Component	Cell body	ISS	26683154
GO:0044877	Function	Protein-containing complex binding	IPI	23921129
GO:0045088	Process	Regulation of innate immune response	TAS	26683154
GO:0045576	Process	Mast cell activation	ISS	26683154
GO:0046330	Process	Positive regulation of JNK cascade	ISS	23921129
GO:0050765	Process	Negative regulation of phagocytosis	TAS	26683154
GO:0050766	Process	Positive regulation of phagocytosis	IBA
GO:0050766	Process	Positive regulation of phagocytosis	ISS	26683154
GO:0050777	Process	Negative regulation of immune response	ISS	26683154
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IMP	24169826
GO:0050869	Process	Negative regulation of B cell activation	TAS	26683154
GO:0071219	Process	Cellular response to molecule of bacterial origin	ISS	26683154
GO:0090264	Process	Regulation of immune complex clearance by monocytes and macrophages	TAS	26683154
GO:1902564	Process	Negative regulation of neutrophil activation	TAS	26683154
GO:1902950	Process	Regulation of dendritic spine maintenance	IGI	23921129
GO:1903381	Process	Regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway	ISS	23921129
GO:1904646	Process	Cellular response to amyloid-beta	ISS	23921129
GO:1905898	Process	Positive regulation of response to endoplasmic reticulum stress	ISS	23921129
GO:2001199	Process	Negative regulation of dendritic cell differentiation	TAS	26683154

Other IDs

• MIM: 604590
• HGNC: 3618
• e!Ensembl: ENSG00000072694

Protein

• UniProt ID: P31994
• Protein name: Low affinity immunoglobulin gamma Fc region receptor II-b (IgG Fc receptor II-b) (CDw32) (Fc-gamma RII-b) (Fc-gamma-RIIb) (FcRII-b) (CD antigen CD32)
• Protein function: Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-ce
• PDB: 2FCB, 3WJJ, 5OCC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	49 → 128	Immunoglobulin domain	Domain
  PF13895	Ig_2	132 → 214	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cel
• Sequence:

  MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
  VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
  SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
  FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
  VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
  LEEPDDQNRI

• Sequence length: 310

Pathways

KEGG:

Virion - Ebolavirus, Lyssavirus and Morbillivirus
Phagosome
Osteoclast differentiation
B cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Staphylococcus aureus infection
Tuberculosis
Measles

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTI-CENTROMERE-ANTIBODY-POSITIVE SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIMITED SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, resistance to	protective; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	ClinVar, GWAS catalog, Orphanet ClinVar, GWAS catalog, Orphanet ClinVar, GWAS catalog, Orphanet ClinVar, GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic lupus erythematosus, susceptibility to	risk factor; protective	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	14508797		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	20179765		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34602489	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16606986		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	29692344	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	22416796, 31820725		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	28223220		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31051414, 31092015		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	21911970	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	17521421	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15547078, 15593228, 17133580, 17521421, 18240208, 18633424, 20398308, 25340460, 27140173, 30963994, 34858391, 37108786	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20735866, 20850384	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24586589, 29597194, 30950681		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24586589	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31051414, 31092015		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	37581400	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	35755170	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	LHGDN	17020818		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	10848805		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	12115230, 15703291, 19261857, 20385827, 20398308, 29692344	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	14613290, 15153543, 16227149, 17312177, 21050737, 21357255, 21724994, 22003931, 22416796, 22841963, 24563255, 25630523, 26133275, 26683154, 29774664, 30370842, 31036800		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	LHGDN	14613290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11753646		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16757681		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22723355		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39874011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32191631	Associate	★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	17900300		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27748757, 28372509		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	27063995		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	30922293	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31479522		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11753646		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21934067		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21934067		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21934067		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	18165525		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29202472, 30261661		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36006018	Associate	★☆☆☆☆ Found in Text Mining only
Erythroblastosis, Fetal	Erythroblastosis Fetalis	BEFREE	19129718		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	30695042	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30695042		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	16846526		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27225222, 29975720, 31302496, 31560714		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40429753	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27225222, 29975720, 31302496, 31560714		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37713871, 40429753	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	23593433	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	31033004		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	31033004	Inhibit	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27832986		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	23593433	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	28492697		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	30034379		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31597453		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	23593433		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	15566359, 23032993, 27315784, 28028748, 30786049, 31270082		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	8849356		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12010811	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	7505024		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	9669838		★☆☆☆☆ Found in Text Mining only
Leukocytoclastic vasculitis	Leukocytoclastic Vasculitis	BEFREE	10417619		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	30695042		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	30719970	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30719970		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15153543, 17133600, 21724994, 22116829, 22841963, 23808414, 27799621, 28960214, 29190833, 29393221, 29774664, 29988500, 30034379, 30373853		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12115230, 15153543, 17130130, 17133600, 19005878, 20385827, 20508037, 21911970, 23261299, 25022320, 26084639, 27799621, 31343409, 34922596	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15153543, 17133600, 21724994, 22116829, 22841963, 23808414, 27799621, 28960214, 29190833, 29393221, 29774664, 29988500, 30034379, 30373853		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10643707, 11561111, 12115230, 14651519, 15153543, 15459183, 15895258, 16115811, 16227149, 16946996, 17130130, 17133600, 17305544, 19005878, 20385827, 20508037, 21187399, 21357255, 21724994, 22116829, 22647731, 22841963, 23261299, 23268649, 23808414, 24366619, 24790152, 25022320, 25475856, 26084639, 27799621, 28960214, 29190833, 29393221, 29497990, 29774664, 29988500, 30026744, 30034379, 30116830, 30373853, 31343409, 31758072, 8849356		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	ORPHANET_DG	12115230, 20385827, 23943494		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	12753656, 15459183, 16115811, 16227149, 16923849, 17130130, 18625651, 19005878		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	24366619, 26980576, 28960214, 29190833, 29508016		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15153543, 17133600, 21724994, 22116829, 22841963, 23808414, 27799621, 28960214, 29190833, 29393221, 29774664, 29988500, 30034379, 30373853		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	1951841		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	14675408, 19452316, 19672774, 34323957	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	10618414, 11753646		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	9787177		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21768293		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12438452, 18798552		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	21208440		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	23341540		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	22565545, 27893416, 30949161		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	22565545, 27893416	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29233917		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33505402	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10935510, 11753646, 24026082, 25851904, 31616964		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	14651519, 29190833		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	CTD_human_DG	10848805		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	27998726		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30261661, 30695042		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29202472, 30261661		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30116830, 31758072		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39972314	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33845841	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29298416		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pericarditis	Pericarditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21338356, 21906057, 22594540		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36148415, 36894919	Associate	★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	14508797		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	23593433	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	12896880		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39780163	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12486608, 15334114, 16356189, 17133580, 22494514, 25630523, 25823782, 27140173, 28106835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17133580		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	BEFREE	22609476		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	37174624	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	30719970		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	30719970	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27849678, 29393221		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	21906057		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	22494514		★☆☆☆☆ Found in Text Mining only
Systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	30719970		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytopenia	Thrombocytopenia	Pubtator	26084639	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	22565545		★☆☆☆☆ Found in Text Mining only
Vasculitis, Leukocytoclastic, Cutaneous	Vasculitis	BEFREE	10417619		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	27330000		★☆☆☆☆ Found in Text Mining only