FCGR2A (Fc gamma receptor IIa)

Gene

• Entrez ID: 2212
• Gene name: Fc gamma receptor IIa
• Gene symbol: FCGR2A
• Synonyms (NCBI Gene): CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, FcGR, FcgammaRIIa, IGFR2
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1801274	A>C,G	Benign, drug-response, risk-factor	Non coding transcript variant, coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT711491	hsa-miR-4275	HITS-CLIP	19536157
MIRT711490	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711489	hsa-miR-1305	HITS-CLIP	19536157
MIRT711491	hsa-miR-4275	HITS-CLIP	19536157
MIRT711490	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711489	hsa-miR-1305	HITS-CLIP	19536157
MIRT711491	hsa-miR-4275	HITS-CLIP	19536157
MIRT711490	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711489	hsa-miR-1305	HITS-CLIP	19536157
MIRT531614	hsa-miR-512-5p	PAR-CLIP	22012620
MIRT531613	hsa-miR-545-3p	PAR-CLIP	22012620
MIRT531612	hsa-miR-6777-3p	PAR-CLIP	22012620
MIRT531611	hsa-miR-6761-5p	PAR-CLIP	22012620
MIRT711491	hsa-miR-4275	HITS-CLIP	19536157
MIRT711490	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711489	hsa-miR-1305	HITS-CLIP	19536157
MIRT711491	hsa-miR-4275	HITS-CLIP	19536157
MIRT711490	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711489	hsa-miR-1305	HITS-CLIP	19536157
MIRT711491	hsa-miR-4275	HITS-CLIP	19536157
MIRT711490	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT711489	hsa-miR-1305	HITS-CLIP	19536157
MIRT531614	hsa-miR-512-5p	PAR-CLIP	22012620
MIRT531613	hsa-miR-545-3p	PAR-CLIP	22012620
MIRT531612	hsa-miR-6777-3p	PAR-CLIP	22012620
MIRT531611	hsa-miR-6761-5p	PAR-CLIP	22012620
MIRT993844	hsa-miR-103a	CLIP-seq
MIRT993845	hsa-miR-107	CLIP-seq
MIRT993846	hsa-miR-1184	CLIP-seq
MIRT993847	hsa-miR-1273g	CLIP-seq
MIRT993848	hsa-miR-188-5p	CLIP-seq
MIRT993849	hsa-miR-324-5p	CLIP-seq
MIRT993850	hsa-miR-4418	CLIP-seq
MIRT993851	hsa-miR-509-3-5p	CLIP-seq
MIRT993852	hsa-miR-509-5p	CLIP-seq
MIRT993853	hsa-miR-3192	CLIP-seq
MIRT993854	hsa-miR-3689a-3p	CLIP-seq
MIRT993855	hsa-miR-3689c	CLIP-seq
MIRT993856	hsa-miR-3929	CLIP-seq
MIRT993857	hsa-miR-4419b	CLIP-seq
MIRT993858	hsa-miR-4478	CLIP-seq
MIRT993859	hsa-miR-4728-5p	CLIP-seq
MIRT993860	hsa-miR-485-5p	CLIP-seq
MIRT1994741	hsa-miR-10a	CLIP-seq
MIRT1994742	hsa-miR-10b	CLIP-seq
MIRT1994743	hsa-miR-339-5p	CLIP-seq
MIRT1994744	hsa-miR-4421	CLIP-seq
MIRT1994745	hsa-miR-4684-5p	CLIP-seq
MIRT993860	hsa-miR-485-5p	CLIP-seq
MIRT1994746	hsa-miR-593	CLIP-seq
MIRT2228887	hsa-miR-194	CLIP-seq
MIRT2228888	hsa-miR-29a	CLIP-seq
MIRT2228889	hsa-miR-29b	CLIP-seq
MIRT2228890	hsa-miR-29c	CLIP-seq
MIRT2228891	hsa-miR-4662a-3p	CLIP-seq
MIRT2228892	hsa-miR-4793-3p	CLIP-seq
MIRT2228893	hsa-miR-508-5p	CLIP-seq
MIRT2228894	hsa-miR-555	CLIP-seq
MIRT2228895	hsa-miR-661	CLIP-seq
MIRT2228896	hsa-miR-766	CLIP-seq
MIRT1994741	hsa-miR-10a	CLIP-seq
MIRT1994742	hsa-miR-10b	CLIP-seq
MIRT1994743	hsa-miR-339-5p	CLIP-seq
MIRT1994744	hsa-miR-4421	CLIP-seq
MIRT1994745	hsa-miR-4684-5p	CLIP-seq
MIRT1994746	hsa-miR-593	CLIP-seq
MIRT1994741	hsa-miR-10a	CLIP-seq
MIRT1994742	hsa-miR-10b	CLIP-seq
MIRT1994743	hsa-miR-339-5p	CLIP-seq
MIRT1994744	hsa-miR-4421	CLIP-seq
MIRT1994745	hsa-miR-4684-5p	CLIP-seq
MIRT1994746	hsa-miR-593	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001788	Process	Antibody-dependent cellular cytotoxicity	IBA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	2139735
GO:0005886	Component	Plasma membrane	TAS
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0019770	Function	IgG receptor activity	IBA
GO:0019864	Function	IgG binding	IBA
GO:0019864	Function	IgG binding	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IBA
GO:0038094	Process	Fc-gamma receptor signaling pathway	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IBA

Other IDs

• MIM: 146790
• HGNC: 3616
• e!Ensembl: ENSG00000143226

Protein

• UniProt ID: P12318
• Protein name: Low affinity immunoglobulin gamma Fc region receptor II-a (IgG Fc receptor II-a) (CDw32) (Fc-gamma RII-a) (Fc-gamma-RIIa) (FcRII-a) (CD antigen CD32)
• Protein function: Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
• PDB: 1FCG, 1H9V, 3D5O, 3RY4, 3RY5, 3RY6, 8CHA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	40 → 119	Immunoglobulin domain	Domain
  PF13895	Ig_2	123 → 205	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Found on monocytes, neutrophils and eosinophil platelets.
• Sequence:

  MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
  TCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVL
  SEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHS
  HSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIY
  CRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDD
  KNIYLTLPPNDHVNSNN

• Sequence length: 317

Pathways

KEGG:

Phagosome
Osteoclast differentiation
Platelet activation
Neutrophil extracellular trap formation
Fc gamma R-mediated phagocytosis
Pathogenic Escherichia coli infection
Yersinia infection
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Coronavirus disease - COVID-19
Systemic lupus erythematosus

Reactome:

FCGR activation
Regulation of actin dynamics for phagocytic cup formation
Role of phospholipids in phagocytosis
Neutrophil degranulation
FCGR3A-mediated IL10 synthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANEMIA, HEMOLYTIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic fibrosis	Uncertain significance	ClinVar CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DIFFUSE SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERYTHROBLASTOSIS, FETAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FCGR2A-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOPHILIA A	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus nephritis, susceptibility to	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, severe, susceptibility to	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, susceptibility to	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudomonas aeruginosa, susceptibility to chronic infection by, in cystic fibrosis	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN'S SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic lupus erythematosus	Uncertain significance	ClinVar ClinVar, GWAS catalog ClinVar, GWAS catalog ClinVar, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
THROMBOCYTOPENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	28039707		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25811666		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	23649770		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31666081, 33081847, 34602489, 35954209	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	27270653		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16606986, 19965803, 21818580		★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Sickle Cell	Anemia	BEFREE	8648541		★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	22559288	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	22559288	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	23749187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antiphospholipid Syndrome	Antiphospholipid Syndrome	LHGDN	12847687		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19055599, 30638300, 31444033		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16277670, 24896836		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	16542359, 24896836	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	12757620	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10193433, 15593228, 17355628, 19898481, 23121884, 24802006, 25392121, 25848939, 31378115, 32508836, 39351328, 40081680	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	22467926		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	28112584		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17291475		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24586589, 29597194, 30950681		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33602227, 36575422	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15583733		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	19055599, 30638300, 31444033		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	30638300	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	LHGDN	17020818		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10675363, 17523948, 18204446, 24916518, 29977032, 34970970, 9674755, 9854050	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	17092257		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18204446, 19640933, 19915573, 20007585, 20848524, 22775462, 24916518, 25900780, 26133275, 27270653, 29977032, 31809536		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	8556514	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17606457		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23270585, 27376362		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25405820		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	34646264	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	32235430	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	21848694	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	29297721	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20697800, 26450443, 29482947		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23379433, 26450443, 27812689, 28952147, 29879453	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30692520, 35812416	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36930102	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30638300		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33441605	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	36316672	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	30638300	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	21317643		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	17652100, 19140833		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	18418394, 20848524		★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	17900300		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	37268894	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	30638300	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	20929558	Associate	★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15217834, 17018637, 20705761		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	15152814		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	27063995		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	20228799, 26826017, 31480888, 33132321	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21042730, 22117530, 27179112, 31479522		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	19164213		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22117530, 22486600, 24884501, 30318772	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	17900300	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	23545275, 25242138		★☆☆☆☆ Found in Text Mining only
Cor pulmonale	Cor pulmonale	HPO_DG			★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20973705, 21934067, 22565545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	20973705, 21934067, 22565545		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22559288, 27893416, 38335505	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20973705, 21934067, 22565545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	20848524, 27490376		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26192919		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31480888	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10853863	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic Fibrosis	Cystic Fibrosis	LHGDN	15367919		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic Fibrosis	Cystic Fibrosis	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Demyelinating Diseases	Demyelinating diseases	Pubtator	23452918	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	18165525		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16421008	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	16421008	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	23141924, 35309299	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37773794	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16609067, 27282998, 28039707		★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	21044892		★☆☆☆☆ Found in Text Mining only
Erythroblastosis, Fetal	Erythroblastosis Fetalis	BEFREE	19129718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32356485	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32356485	Associate	★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibrocystic Disease of Pancreas	Cystic fibrosis of pancreas	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	9854050	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	16846526		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant cell arteritis	Pubtator	16846526	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	29975720		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29975720		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33875619	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	28891817		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	23593433	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	15744239	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	10513795	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	9854050	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	31033004		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	31033004	Inhibit	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	27064330, 27609290, 30232664		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	27064330		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28719596, 30659276		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34285919	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	37268894	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	20929558, 24916518	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	24916518	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemophilia A	Hemophilia	BEFREE	28492697		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heparin Cofactor II Deficiency	Heparin cofactor 2 deficiency	Pubtator	21848694, 25680756, 37102605, 9674755, 9716579	Associate	★☆☆☆☆ Found in Text Mining only
Heparin Cofactor II Deficiency	Heparin cofactor 2 deficiency	Pubtator	34189574	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	37108648	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	27742794	Associate	★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	23545275		★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29155175		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20929558		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20929558, 21309737	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	23593433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune system disease	Pubtator	19898481, 26996483, 8556514	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	21131591, 22123287, 23032993, 23249566, 23545275, 25457587, 27315784, 28856973, 28942727, 30445311, 30786049, 31270082		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	20848524, 31031776, 31480888		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233, 26192919, 28067908		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31480888	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	37648784	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	23141924	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19357503, 20034444		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12571856, 31509231, 9350662	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	8849356		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	7505024		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15744239, 29720577	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	9669838		★☆☆☆☆ Found in Text Mining only
Leukocytoclastic vasculitis	Leukocytoclastic Vasculitis	BEFREE	10417619		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	18204446		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15004265, 21792837, 23808414		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10513796, 11145038, 11229467, 12176802, 12209518, 12960360, 15194589, 15535834, 16968408, 18204446, 1834376, 21719445, 21792837, 22559288, 24896836, 30638300, 32576231, 36371989, 36706536, 37029410, 8636449	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15004265, 21792837, 23808414		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10643707, 11561111, 14651519, 15004265, 15153543, 16227149, 17092257, 17305544, 17665457, 18204446, 19357696, 20508037, 20848524, 21768177, 21792837, 22933624, 23808414, 24366619, 24896836, 24997134, 25086072, 26396093, 27538381, 30610165, 30638300, 31444033, 8849356, 8994865		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15004265, 17092253, 17092257		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	18204446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	18204446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26502338, 27399966, 28714469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	11229467, 24896836, 31509231, 8636449, 9350662, 9496155	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	LHGDN	12115187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	15004265, 24366619, 24997134, 8636449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15004265, 21792837, 23808414		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15217834, 1951841		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15217834, 31919622	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21250972	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	19672774, 34323957	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	17704420, 22885164, 25596266		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17018637, 21250972, 9787177		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	18474295		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	17018637		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28719596, 30659276		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20697800, 26450443, 29482947		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23994584		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21780194		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23994584, 27179112, 28952147, 30692520, 31809536		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18347005		★☆☆☆☆ Found in Text Mining only
Meconium ileus	Meconium ileus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	21208440		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere disease	Pubtator	21208440	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	29025244	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	22081228, 22446962, 22565545, 23545275, 24162006, 25093412, 25405820, 25470559, 25556045, 26089602, 26125827, 27270653, 27893416, 28886140, 30949161, 31816620		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	GWASCAT_DG	22081228, 28886140		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	GWASDB_DG	22081228		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	CTD_human_DG	22081228, 22446962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	22565545, 25101798, 25645453, 26089602, 27893416, 28886140, 30949161, 33772158, 34193364, 36536067, 39359734	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	17315188, 29233917		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25510242	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	31682087		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	LHGDN	14597109		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30968301		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	38335505	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10935510, 24884501, 25851904, 31031746		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	15004265, 24997134, 28891817		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	29155175		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16682723		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	27998726		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	21719445		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	29025244	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	29025244	Associate	★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	12834496		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	23649770		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36316672	Associate	★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	25405820		★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	24487381		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	24617727		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23994584		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	37029410	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24048425, 26613086		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	26613086	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	12896880		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	12896880	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39780163	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	20929558	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Prolapse	Rectal Prolapse	HPO_DG			★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	33766078	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12064825, 12508778, 16569263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12734884, 15334114, 16356189, 18843786, 18930989, 19700393, 21607711, 22467926, 22494514, 24667440, 25823782, 25823785, 25848939, 26314337, 26396093, 27074847, 28106835, 28112584, 28607508, 29464314, 31378115		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	20453842, 23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	24532676		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	LHGDN	17291475		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	22609476, 26801149, 28472129		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	37174624	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	37174624	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	40081680	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22580203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	39351328	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	17704420, 20550522, 22327884, 23171437, 24884501, 25011934, 26363448, 30318772, 30796344, 31097738		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	18372357, 38166692	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	19494086	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26490967, 26496101		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	36609675	Associate	★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	24097067	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren`s Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097067		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	27938998	Associate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	22494514, 27490376		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	22494514	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27217441, 34285919	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27938998		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21780194		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	23141924	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	38335505	Stimulate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	20551103		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	23830517, 24548718, 25405820, 26996483, 27769046		★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	Pubtator	19197137	Associate	★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	BEFREE	28078347		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	24617727		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	12871511, 19197137, 9674755, 9716579	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	BEFREE	28416511, 30917957		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	16421008, 19197137, 23141924, 25680756, 30692520, 34753174, 9716579	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	19915573, 20228799		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASDB_DG	19915573, 21297633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	19915573, 21297633, 26192919, 28067908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	20228799, 20848524, 21831733, 23917248, 25787843, 26398853, 27270653, 28604414, 30260678, 30876876, 30995495, 31031776, 31480888		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	BEFREE	25086072, 25405820		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	37331172	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis, Leukocytoclastic, Cutaneous	Vasculitis	BEFREE	10417619		★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	30299252	Associate	★☆☆☆☆ Found in Text Mining only