PRSS54 (serine protease 54)

Gene

• Entrez ID: 221191
• Gene name: Serine protease 54
• Gene symbol: PRSS54
• Synonyms (NCBI Gene): CT67, KLKBL4
• Chromosome: 16
• Chromosome location: 16q21
• Summary: This gene encodes a putative serine-type endopeptidase containing the peptidase S1 domain. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2015]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2457273	hsa-miR-199a-5p	CLIP-seq
MIRT2457274	hsa-miR-199b-5p	CLIP-seq
MIRT2457275	hsa-miR-3194-5p	CLIP-seq
MIRT2457276	hsa-miR-4659a-5p	CLIP-seq
MIRT2457277	hsa-miR-4659b-5p	CLIP-seq
MIRT2457278	hsa-miR-4690-3p	CLIP-seq
MIRT2602257	hsa-miR-3117-5p	CLIP-seq
MIRT2602258	hsa-miR-338-3p	CLIP-seq
MIRT2602259	hsa-miR-4310	CLIP-seq
MIRT2602260	hsa-miR-4457	CLIP-seq
MIRT2602261	hsa-miR-4662a-5p	CLIP-seq
MIRT2602262	hsa-miR-4676-5p	CLIP-seq
MIRT2602263	hsa-miR-513b	CLIP-seq
MIRT2602264	hsa-miR-575	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6PEW0
• Protein name: Inactive serine protease 54 (Cancer/testis antigen 67) (CT67) (Plasma kallikrein-like protein 4)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	47 → 264	Trypsin	Domain

• Sequence:

  MVSAAGLSGDGKMRGVLLVLLGLLYSSTSCGVQKASVFYGPDPKEGLVSSMEFPWVVSLQ
  DSQYTHLAFGCILSEFWVLSIASAIQNRKDIVVIVGISNMDPSKIAHTEYPVNTIIIHED
  FDNNSMSNNIALLKTDTAMHFGNLVQSICFLGRMLHTPPVLQNCWVSGWNPTSATGNHMT
  MSVLRKIFVKDLDMCPLYKLQKTECGSHTKEETKTACLGDPGSPMMCQLQQFDLWVLRGV
  LNFGGETCPGLFLYTKVEDYSKWITSKAERAGPPLSSLHHWEKLISFSHHGPNATMTQKT
  YSDSELGHVGSYLQGQRRTITHSRLGNSSRDSLDVREKDVKESGRSPEASVQPLYYDYYG
  GEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI

• Sequence length: 395

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26773925		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39208330	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	26773925		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	39208330	Associate	★☆☆☆☆ Found in Text Mining only