Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	221150
Gene name	Spindle and kinetochore associated complex subunit 3
Gene symbol	SKA3
Synonyms (NCBI Gene)	C13orf3RAMA1
Chromosome	13
Chromosome location	13q12.11
Summary	This gene encodes a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromos

Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052469	hsa-let-7a-5p	CLASH	23622248
MIRT041438	hsa-miR-193b-3p	CLASH	23622248
MIRT739086	hsa-miR-148b	HITS-CLIP	33718276
MIRT739088	hsa-miR-148a	HITS-CLIP	33718276
MIRT1350847	hsa-miR-1206	CLIP-seq
MIRT1350848	hsa-miR-1207-5p	CLIP-seq
MIRT1350849	hsa-miR-1263	CLIP-seq
MIRT1350850	hsa-miR-1272	CLIP-seq
MIRT739104	hsa-miR-127-5p	CLIP-seq
MIRT1350851	hsa-miR-128	CLIP-seq
MIRT1350852	hsa-miR-1322	CLIP-seq
MIRT1350853	hsa-miR-133a	CLIP-seq
MIRT1350854	hsa-miR-133b	CLIP-seq
MIRT1350855	hsa-miR-1470	CLIP-seq
MIRT1350856	hsa-miR-1827	CLIP-seq
MIRT1350857	hsa-miR-203	CLIP-seq
MIRT1350858	hsa-miR-2053	CLIP-seq
MIRT1350859	hsa-miR-27a	CLIP-seq
MIRT1350860	hsa-miR-27b	CLIP-seq
MIRT1350861	hsa-miR-3064-5p	CLIP-seq
MIRT1350862	hsa-miR-3189-3p	CLIP-seq
MIRT1350863	hsa-miR-320a	CLIP-seq
MIRT1350864	hsa-miR-320b	CLIP-seq
MIRT1350865	hsa-miR-320c	CLIP-seq
MIRT1350866	hsa-miR-320d	CLIP-seq
MIRT1350867	hsa-miR-320e	CLIP-seq
MIRT1350868	hsa-miR-326	CLIP-seq
MIRT1350869	hsa-miR-330-5p	CLIP-seq
MIRT1350870	hsa-miR-3652	CLIP-seq
MIRT1350871	hsa-miR-3662	CLIP-seq
MIRT1350872	hsa-miR-3908	CLIP-seq
MIRT1350873	hsa-miR-3938	CLIP-seq
MIRT1350874	hsa-miR-3942-5p	CLIP-seq
MIRT1350875	hsa-miR-409-3p	CLIP-seq
MIRT1350876	hsa-miR-4422	CLIP-seq
MIRT1350877	hsa-miR-4429	CLIP-seq
MIRT1350878	hsa-miR-4430	CLIP-seq
MIRT1350879	hsa-miR-4487	CLIP-seq
MIRT1350880	hsa-miR-4505	CLIP-seq
MIRT1350881	hsa-miR-4506	CLIP-seq
MIRT739100	hsa-miR-4514	CLIP-seq
MIRT1350882	hsa-miR-4639-3p	CLIP-seq
MIRT739103	hsa-miR-4645-5p	CLIP-seq
MIRT739099	hsa-miR-4660	CLIP-seq
MIRT1350883	hsa-miR-4667-3p	CLIP-seq
MIRT739102	hsa-miR-4673	CLIP-seq
MIRT739101	hsa-miR-4692	CLIP-seq
MIRT1350884	hsa-miR-4703-5p	CLIP-seq
MIRT1350885	hsa-miR-4716-3p	CLIP-seq
MIRT1350886	hsa-miR-4738-3p	CLIP-seq
MIRT1350887	hsa-miR-4763-3p	CLIP-seq
MIRT1350888	hsa-miR-511	CLIP-seq
MIRT1350889	hsa-miR-513a-5p	CLIP-seq
MIRT739098	hsa-miR-516b	CLIP-seq
MIRT1350890	hsa-miR-545	CLIP-seq
MIRT1350891	hsa-miR-569	CLIP-seq
MIRT1350892	hsa-miR-593	CLIP-seq
MIRT1350893	hsa-miR-642a	CLIP-seq
MIRT1350894	hsa-miR-646	CLIP-seq
MIRT1350895	hsa-miR-656	CLIP-seq
MIRT1350896	hsa-miR-7	CLIP-seq
MIRT1350897	hsa-miR-885-3p	CLIP-seq
MIRT1350898	hsa-miR-940	CLIP-seq
MIRT2103941	hsa-miR-3607-5p	CLIP-seq
MIRT2103942	hsa-miR-3689a-5p	CLIP-seq
MIRT2103943	hsa-miR-3689b	CLIP-seq
MIRT2103944	hsa-miR-3689e	CLIP-seq
MIRT2103945	hsa-miR-3689f	CLIP-seq
MIRT2103946	hsa-miR-4520a-3p	CLIP-seq
MIRT739089	hsa-miR-132	CLIP-seq
MIRT739087	hsa-miR-152	CLIP-seq
MIRT739090	hsa-miR-212	CLIP-seq
MIRT1350874	hsa-miR-3942-5p	CLIP-seq
MIRT2459434	hsa-miR-4452	CLIP-seq
MIRT1350884	hsa-miR-4703-5p	CLIP-seq
MIRT1350890	hsa-miR-545	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IMP	19289083
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	20813266
GO:0000776	Component	Kinetochore	IEA
GO:0000776	Component	Kinetochore	IPI	21633384
GO:0000940	Component	Outer kinetochore	IBA
GO:0000940	Component	Outer kinetochore	IDA	19289083, 19646878, 28479321
GO:0000940	Component	Outer kinetochore	IEA
GO:0005515	Function	Protein binding	IPI	19289083, 19360002, 26496610, 28479321, 28514442, 31515488, 32296183, 33961781
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	19646878
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0005876	Component	Spindle microtubule	IDA	19289083
GO:0007056	Process	Spindle assembly involved in female meiosis	IEA
GO:0007056	Process	Spindle assembly involved in female meiosis	ISS
GO:0007059	Process	Chromosome segregation	IBA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IPI	28495837
GO:0008017	Function	Microtubule binding	IDA	29487209
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IDA	19289083
GO:0051296	Process	Establishment of meiotic spindle orientation	IEA
GO:0051296	Process	Establishment of meiotic spindle orientation	ISS
GO:0051301	Process	Cell division	IEA
GO:0051310	Process	Metaphase chromosome alignment	IMP	22371557
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IDA	29487209
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IMP	28479321
GO:0072686	Component	Mitotic spindle	IDA	19646878
GO:0072687	Component	Meiotic spindle	IEA
GO:0140499	Process	Negative regulation of mitotic spindle assembly checkpoint signaling	IMP	19646878
GO:0170027	Component	SKA complex	IDA	31804178

MIM	HGNC	e!Ensembl
619247	20262	ENSG00000165480

Q8IX90

Protein name

Spindle and kinetochore-associated protein 3

Protein function

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:19289083, PubMed:19360002, PubMed:23085020). The SKA1 complex is a direct component of the kinet

PDB

4AJ5

Family and domains

Sequence

MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNI
LLDKARLENQEGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSD
PELSNCENFQKTDVKDDLSDPPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVN
NYKEEPVIVTPPTKQSLVKVLKTPKCALKMDDFECVTPKLEHFGISEYTMCLNEDYTMGL
KNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEYTNSPLVPTFCTPGLKIPSTK
NSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPT
PPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN

Sequence length

412

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma of large intestine	Colorectal adenoma	BEFREE	27329586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	30402980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30506958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23496902, 32799774, 37180139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30402980, 35546682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34045512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30459531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30459531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	30402980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37821935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	27329586	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27329586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34544967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37821935	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	34545328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31804459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34806315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30506958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26429724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30459531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	30402980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	30402980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35689754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30459531, 31804459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26429724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32902196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35546682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32799774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SKA3 (spindle and kinetochore associated complex subunit 3)