Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	221061
Gene name	Family with sequence similarity 171 member A1
Gene symbol	FAM171A1
Synonyms (NCBI Gene)	APCNC10orf38
Chromosome	10
Chromosome location	10p13

Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022483	hsa-miR-124-3p	Microarray	18668037
MIRT027016	hsa-miR-103a-3p	Sequencing	20371350
MIRT027931	hsa-miR-96-5p	Sequencing	20371350
MIRT037282	hsa-miR-877-5p	CLASH	23622248
MIRT981948	hsa-miR-139-3p	CLIP-seq
MIRT981949	hsa-miR-2115	CLIP-seq
MIRT981950	hsa-miR-3121-5p	CLIP-seq
MIRT981951	hsa-miR-3124-3p	CLIP-seq
MIRT981952	hsa-miR-3145-3p	CLIP-seq
MIRT981953	hsa-miR-3200-3p	CLIP-seq
MIRT981954	hsa-miR-3672	CLIP-seq
MIRT981955	hsa-miR-3912	CLIP-seq
MIRT981956	hsa-miR-3925-5p	CLIP-seq
MIRT981957	hsa-miR-539	CLIP-seq
MIRT2225159	hsa-miR-1208	CLIP-seq
MIRT2225160	hsa-miR-1267	CLIP-seq
MIRT2225161	hsa-miR-128	CLIP-seq
MIRT2225162	hsa-miR-27a	CLIP-seq
MIRT2225163	hsa-miR-27b	CLIP-seq
MIRT2225164	hsa-miR-3120-5p	CLIP-seq
MIRT2225165	hsa-miR-3159	CLIP-seq
MIRT2225166	hsa-miR-501-5p	CLIP-seq
MIRT2225167	hsa-miR-513a-5p	CLIP-seq
MIRT2225168	hsa-miR-513c	CLIP-seq
MIRT2225169	hsa-miR-514b-5p	CLIP-seq
MIRT2225170	hsa-miR-668	CLIP-seq
MIRT2387755	hsa-miR-1261	CLIP-seq
MIRT2225161	hsa-miR-128	CLIP-seq
MIRT2225162	hsa-miR-27a	CLIP-seq
MIRT2225163	hsa-miR-27b	CLIP-seq
MIRT2225165	hsa-miR-3159	CLIP-seq
MIRT2387756	hsa-miR-3614-5p	CLIP-seq
MIRT2387757	hsa-miR-3689a-5p	CLIP-seq
MIRT2387758	hsa-miR-3689b	CLIP-seq
MIRT2387759	hsa-miR-3689e	CLIP-seq
MIRT2387760	hsa-miR-3689f	CLIP-seq
MIRT2387761	hsa-miR-432	CLIP-seq
MIRT2387762	hsa-miR-4424	CLIP-seq
MIRT2225167	hsa-miR-513a-5p	CLIP-seq
MIRT2225168	hsa-miR-513c	CLIP-seq
MIRT2225169	hsa-miR-514b-5p	CLIP-seq
MIRT2387763	hsa-miR-890	CLIP-seq
MIRT2528663	hsa-miR-103a	CLIP-seq
MIRT2528664	hsa-miR-107	CLIP-seq
MIRT2528665	hsa-miR-183	CLIP-seq
MIRT2387756	hsa-miR-3614-5p	CLIP-seq
MIRT2528666	hsa-miR-4422	CLIP-seq
MIRT2528667	hsa-miR-548p	CLIP-seq
MIRT2528668	hsa-miR-885-3p	CLIP-seq
MIRT2528663	hsa-miR-103a	CLIP-seq
MIRT2528664	hsa-miR-107	CLIP-seq
MIRT2528665	hsa-miR-183	CLIP-seq
MIRT2387756	hsa-miR-3614-5p	CLIP-seq
MIRT2680582	hsa-miR-4311	CLIP-seq
MIRT2528666	hsa-miR-4422	CLIP-seq
MIRT2528667	hsa-miR-548p	CLIP-seq
MIRT2528668	hsa-miR-885-3p	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	30312582, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	30312582
GO:0005886	Component	Plasma membrane	IEA
GO:0008360	Process	Regulation of cell shape	IBA
GO:0008360	Process	Regulation of cell shape	IMP	30312582
GO:0016020	Component	Membrane	IEA
GO:0043149	Process	Stress fiber assembly	IBA
GO:0043149	Process	Stress fiber assembly	IMP	30312582

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5VUB5

Protein name

Protein FAM171A1 (Astroprincin) (APCN)

Protein function

Involved in the regulation of the cytoskeletal dynamics, plays a role in actin stress fiber formation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10577	UPF0560	34 → 888	Uncharacterised protein family UPF0560	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, liver, skeletal muscle, kidney and pancreas (PubMed:30312582). In brain, expressed by glia, pyramidal neurons and astrocytes (at protein level) (PubMed:30312582). Highly expressed in placental trophoblasts (P

Sequence

MSRSATLLLCLLGCHVWKAVTKTLREPGAGAQEVTLKVHISDASTHQPVADALIEIFTNQ
ASIASGTSGTDGVAFIKFQYKLGSQLIVTASKHAYVPNSAPWKPIRLPVFSSLSLGLLPE
RSATLMVYEDVVQIVSGFQGARPQPRVHFQRRALRLPENTSYSDLTAFLTAASSPSEVDS
FPYLRGLDGNGTGNSTRHDLTPVTAVSVHLLSSNGTPVLVDGPIYVTVPLATQSSLRHNA
YVAAWRFDQKLGTWLKSGLGLVHQEGSQLTWTYIAPQLGYWVAAMSPPIPGPVVTQDITT
YHTVFLLAILGGMAFILLVLLCLLLYYCRRKCLKPRQHHRKLQLPAGLESSKRDQSTSMS
HINLLFSRRASEFPGPLSVTSHGRPEAPGTKELMSGVHLEMMSPGGEGDLHTPMLKLSYS
TSQEFSSREELLSCKEEDKSQISFDNLTPSGTLGKDYHKSVEVFPLKARKSMEREGYESS
GNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQEHLYPAPSSPEKEQLLDRRPTECM
MSRSVDHLERPTSFPRPGQLICCSSVDQVNDSVYRKVLPALVIPAHYMKLPGDHSYVSQP
LVVPADQQLEIERLQAELSNPHAGIFPHPSSQIQPQPLSSQAISQQHLQDAGTREWSPQN
ASMSESLSIPASLNDAALAQMNSEVQLLTEKALMELGGGKPLPHPRAWFVSLDGRSNAHV
RHSYIDLQRAGRNGSNDASLDSGVDMNEPKSARKGRGDALSLQQNYPPVQEHQQKEPRAP
DSTAYTQLVYLDDVEQSGSECGTTVCTPEDSALRCLLEGSSRRSGGQLPSLQEETTRRTA
DAPSEPAASPHQRRSAHEEEEDDDDDDQGEDKKSPWQKREERPLMAFNIK

Sequence length

890

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART MALFORMATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELECTIVE IGA DEFICIENCY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	18703228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30631046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34481452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30631046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30631046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	36050999, 36147639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30631046, 31649243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31649243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FAM171A1 (family with sequence similarity 171 member A1)