Gene Gene information from NCBI Gene database.
Entrez ID 220988
Gene name Heterogeneous nuclear ribonucleoprotein A3
Gene symbol HNRNPA3
Synonyms (NCBI Gene)
2610510D13RikD10S102FBRNPHNRPA3
Chromosome 2
Chromosome location 2q31.2
miRNA miRNA information provided by mirtarbase database.
954
miRTarBase ID miRNA Experiments Reference
MIRT020978 hsa-miR-155-5p Proteomics 19193853
MIRT020978 hsa-miR-155-5p Other 20584899
MIRT020978 hsa-miR-155-5p Proteomics 17881434
MIRT024046 hsa-miR-1-3p Proteomics 18668040
MIRT042699 hsa-miR-346 CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IBA
GO:0000398 Process MRNA splicing, via spliceosome IC 11991638
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605372 24941 ENSG00000170144
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P51991
Protein name Heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3)
Protein function Plays a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element, A2RE. May be involved in pre-mRNA splicing.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 37 106 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 128 199 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGT
LTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVE
PKRAVSREDSVKPG
AHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTV
DKIVVQKYHTINGHNCEVK
KALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRG
GNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQG
GGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPY
GGGYGSGGGSGGYGSRRF
Sequence length 378
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Spliceosome
Amyotrophic lateral sclerosis
  mRNA Splicing - Major Pathway
Processing of Capped Intron-Containing Pre-mRNA
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SCHIZOPHRENIA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 30040709 Associate
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 29131108
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic Lateral Sclerosis BEFREE 29131108
★☆☆☆☆
Found in Text Mining only
Familial medullary thyroid carcinoma Medullary thyroid carcinoma BEFREE 8093642
★☆☆☆☆
Found in Text Mining only
Frontotemporal Lobar Degeneration Frontotemporal dementia BEFREE 28431575
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 29687002 Associate
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung Neoplasms BEFREE 24246049
★☆☆☆☆
Found in Text Mining only
Medullary carcinoma of thyroid Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome BEFREE 8093642
★☆☆☆☆
Found in Text Mining only
Motor Neuron Disease Motor Neuron Disease BEFREE 28431575
★☆☆☆☆
Found in Text Mining only
Motor Neuron Disease Motor neuron disease Pubtator 28431575 Associate
★☆☆☆☆
Found in Text Mining only