FCER2 (Fc epsilon receptor II)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 2208
Gene name Fc epsilon receptor II
Gene symbol FCER2
Synonyms (NCBI Gene)
BLAST-2CD23CD23ACLEC4JFCE2FCErIIIGEBF
Chromosome 19
Chromosome location 19p13.2
Summary The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, the
miRNA miRNA information provided by mirtarbase database.
11
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (11)
miRTarBase ID miRNA Experiments Reference
MIRT2228842 hsa-miR-1182 CLIP-seq
MIRT2228843 hsa-miR-1275 CLIP-seq
MIRT2228844 hsa-miR-193a-5p CLIP-seq
MIRT2228845 hsa-miR-3127-5p CLIP-seq
MIRT2228846 hsa-miR-3194-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
5
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (5)
Transcription factor Regulation Reference
BCL6 Repression 11342629
EGR1 Repression 9300687
IRF4 Activation 11342629
PAX5 Unknown 12731041
STAT6 Activation 9686563
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (27)
GO ID Ontology Definition Evidence Reference
GO:0002020 Function Protease binding IPI 12777399
GO:0002450 Process B cell antigen processing and presentation IDA 2167225
GO:0002925 Process Positive regulation of humoral immune response mediated by circulating immunoglobulin IEA
GO:0005178 Function Integrin binding TAS 2529542
GO:0005515 Function Protein binding IPI 16172256, 25416956
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
151445 3612 ENSG00000104921
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P06734
Protein name Low affinity immunoglobulin epsilon Fc receptor (BLAST-2) (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor) (CD antigen CD23) [Cleaved into: Low affinity immunoglobulin epsilon Fc recepto
Protein function Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B cells. On B cells, initiates IgE-dependent antigen uptake and presentation to T cells (PubMed:
PDB 1T8C , 1T8D , 2H2R , 2H2T , 4EZM , 4G96 , 4G9A , 4GI0 , 4GJ0 , 4GJX , 4GK1 , 4GKO , 4J6J , 4J6K , 4J6L , 4J6M , 4J6N , 4J6P , 4J6Q , 4KI1 , 5LGK , 6Y0L , 6Y0M
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 180 → 284 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in urine (at protein level). {ECO:0000269|PubMed:37453717}.
Sequence 
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS
Sequence length 321
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Hematopoietic cell lineage
Epstein-Barr virus infection 		  NOTCH2 intracellular domain regulates transcription
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (3)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ENCEPHALITIS — CTD, Disgenet
CTD, Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY, IMMEDIATE — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE — CTD, Disgenet
CTD, Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (118)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 11224610
★★★★★
★☆☆☆☆
Found in Text Mining only
Allergic sensitization Allergic Sensitization BEFREE 28361904
★★★★★
★☆☆☆☆
Found in Text Mining only
Alveolitis Extrinsic Allergic Extrinsic allergic alveolitis Pubtator 2139100 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 9394977 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Anemia Anemia Pubtator 11920534 Inhibit
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis Pubtator 1827636 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 1829991, 2532990, 30649469 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 1401914, 17980418, 19571570, 21958076, 22059556, 24102092, 24354852, 27026514, 29251255, 29279058, 30013551
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 37076662, 8222326 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism Pubtator 24884537 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only