FCER1G (Fc epsilon receptor Ig)

Gene

• Entrez ID: 2207
• Gene name: Fc epsilon receptor Ig
• Gene symbol: FCER1G
• Synonyms (NCBI Gene): FCRG
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT054333	hsa-miR-1225-3p	Microarray, qRT-PCR	23593351
MIRT993751	hsa-miR-2110	CLIP-seq
MIRT993752	hsa-miR-3135b	CLIP-seq
MIRT993753	hsa-miR-4259	CLIP-seq
MIRT993754	hsa-miR-4271	CLIP-seq
MIRT993755	hsa-miR-4425	CLIP-seq
MIRT993756	hsa-miR-4653-3p	CLIP-seq
MIRT993757	hsa-miR-4725-3p	CLIP-seq
MIRT993758	hsa-miR-571	CLIP-seq
MIRT2228832	hsa-miR-3616-3p	CLIP-seq
MIRT2228833	hsa-miR-3652	CLIP-seq
MIRT2228834	hsa-miR-4430	CLIP-seq
MIRT2228835	hsa-miR-4446-3p	CLIP-seq
MIRT2228836	hsa-miR-4492	CLIP-seq
MIRT2228837	hsa-miR-4498	CLIP-seq
MIRT2228838	hsa-miR-4721	CLIP-seq
MIRT2228839	hsa-miR-548b-3p	CLIP-seq
MIRT2228840	hsa-miR-7	CLIP-seq
MIRT2228841	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001798	Process	Positive regulation of type IIa hypersensitivity	IEA
GO:0001805	Process	Positive regulation of type III hypersensitivity	IEA
GO:0001812	Process	Positive regulation of type I hypersensitivity	IEA
GO:0002283	Process	Neutrophil activation involved in immune response	IBA
GO:0002283	Process	Neutrophil activation involved in immune response	IEA
GO:0002292	Process	T cell differentiation involved in immune response	IBA
GO:0002292	Process	T cell differentiation involved in immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002431	Process	Fc receptor mediated stimulatory signaling pathway	IBA
GO:0002431	Process	Fc receptor mediated stimulatory signaling pathway	IEA
GO:0002554	Process	Serotonin secretion by platelet	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	8810294, 9280292, 16735691, 20959446, 22291008, 26311901, 29143175
GO:0005886	Component	Plasma membrane	IDA	16735691
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006911	Process	Phagocytosis, engulfment	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	1535625
GO:0009986	Component	Cell surface	IEA
GO:0010543	Process	Regulation of platelet activation	IBA
GO:0010543	Process	Regulation of platelet activation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IBA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0019767	Function	IgE receptor activity	IBA
GO:0019767	Function	IgE receptor activity	IEA
GO:0019863	Function	IgE binding	IEA
GO:0019863	Function	IgE binding	IEA
GO:0019864	Function	IgG binding	IBA
GO:0019864	Function	IgG binding	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0031623	Process	Receptor internalization	IEA
GO:0031623	Process	Receptor internalization	ISS
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032765	Process	Positive regulation of mast cell cytokine production	IEA
GO:0032998	Component	Fc-epsilon receptor I complex	IBA
GO:0032998	Component	Fc-epsilon receptor I complex	IEA
GO:0033001	Component	Fc-gamma receptor III complex	IDA	28652325
GO:0033024	Process	Mast cell apoptotic process	IEA
GO:0033026	Process	Negative regulation of mast cell apoptotic process	IEA
GO:0038094	Process	Fc-gamma receptor signaling pathway	IBA
GO:0038094	Process	Fc-gamma receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IMP	16735691
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IEA
GO:0038156	Process	Interleukin-3-mediated signaling pathway	ISS
GO:0042590	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I	IBA
GO:0042590	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I	IEA
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042802	Function	Identical protein binding	IDA	14967045
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	28652325
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043306	Process	Positive regulation of mast cell degranulation	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045576	Process	Mast cell activation	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IBA
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050776	Process	Regulation of immune response	IEA
GO:0050778	Process	Positive regulation of immune response	IEA
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	IEA
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0098797	Component	Plasma membrane protein complex	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:2000010	Process	Positive regulation of protein localization to cell surface	IEA

Other IDs

• MIM: 147139
• HGNC: 3611
• e!Ensembl: ENSG00000158869

Protein

• UniProt ID: P30273
• Protein name: High affinity immunoglobulin epsilon receptor subunit gamma (Fc receptor gamma-chain) (FcRgamma) (Fc-epsilon RI-gamma) (IgE Fc receptor subunit gamma) (FceRI gamma)
• Protein function: Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammat
• PDB: 7Q5T, 8YVU, 8YWA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11628	TCR_zetazeta	21 → 51	T-cell surface glycoprotein CD3 zeta chain	Family
  PF02189	ITAM	62 → 81	Immunoreceptor tyrosine-based activation motif	Motif

• Sequence:

  MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
  SDGVYTGLSTRNQETYETLKHEKPPQ

• Sequence length: 86

Pathways

KEGG:

Sphingolipid signaling pathway
Phospholipase D signaling pathway
Platelet activation
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
Fc epsilon RI signaling pathway
Tuberculosis
Asthma

Reactome:

GPVI-mediated activation cascade
Cell surface interactions at the vascular wall
Fc epsilon receptor (FCERI) signaling
Role of LAT2/NTAL/LAB on calcium mobilization
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
FCERI mediated NF-kB activation
Dectin-2 family
Neutrophil degranulation
Platelet Adhesion to exposed collagen

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31333911		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	GWASCAT_DG	30013184		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35436980	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Aplastic	Aplastic anemia	Pubtator	22401598	Inhibit	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	34814367	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30858848		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23146195	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18595682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	30929738, 31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	18595682		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34925641, 39702436	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	12626537, 17692570	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37081323	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29209141	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35120484	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	34140767	Associate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29209141		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	22150093, 31251950		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22150093, 31251950		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34257539	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32894197	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	26712042	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32888289	Associate	★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	9739060		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	18378679	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	28815933		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	33659005	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25757160, 29286103	Associate	★☆☆☆☆ Found in Text Mining only
LIPOPROTEIN GLOMERULOPATHY	Lipoprotein Glomerulopathy	BEFREE	16431249, 22863838		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35726350	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	18714041		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11352243	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12626537, 12847689, 17692570, 17878388, 18714041, 19018007, 19201859, 26582197	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	18714041		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12847689, 18714041, 26582197		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	31638917	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	18714041		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33177155, 35135212	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	20406964		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37170758	Inhibit	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23228155		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	32594092, 33847684	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36466903	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	9739060		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35078433	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	26792385	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	35711523	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	30545925	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	35246248	Associate	★☆☆☆☆ Found in Text Mining only