Gene Gene information from NCBI Gene database.
Entrez ID 220441
Gene name Ring finger protein 152
Gene symbol RNF152
Synonyms (NCBI Gene)
-
Chromosome 18
Chromosome location 18q21.33
miRNA miRNA information provided by mirtarbase database.
352
miRTarBase ID miRNA Experiments Reference
MIRT039527 hsa-miR-652-3p CLASH 23622248
MIRT607092 hsa-miR-4731-3p HITS-CLIP 22927820
MIRT607091 hsa-miR-4801 HITS-CLIP 22927820
MIRT607090 hsa-miR-8485 HITS-CLIP 22927820
MIRT607089 hsa-miR-4789-3p HITS-CLIP 22927820
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
48
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IEA
GO:0002181 Process Cytoplasmic translation IDA 8706699, 34314702
GO:0004842 Function Ubiquitin-protein transferase activity IDA 21203937
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005764 Component Lysosome IDA 21203937
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616512 26811 ENSG00000176641
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N8N0
Protein name E3 ubiquitin-protein ligase RNF152 (EC 2.3.2.27) (RING finger protein 152) (RING-type E3 ubiquitin transferase RNF152)
Protein function E3 ubiquitin-protein ligase that acts as a negative regulator of mTORC1 signaling by mediating ubiquitination of RagA/RRAGA and RHEB (PubMed:25936802, PubMed:30514904). Catalyzes 'Lys-63'-linked polyubiquitination of RagA/RRAGA in response to am
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14634 zf-RING_5 11 56 zinc-RING finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:21203937}.
Sequence
METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKL
PPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCR
LLPGSQQKSVTVVTIPAEQQPLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLV
FLLGIVLHNMSCISKRFTVISCG
Sequence length 203
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  mTOR signaling pathway   E3 ubiquitin ligases ubiquitinate target proteins
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
EBV-positive nodal T- and NK-cell lymphoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TOOTH DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Carcinoma Colorectal Cancer BEFREE 30662620
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic Metastasis BEFREE 30662620
★☆☆☆☆
Found in Text Mining only