Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2204
Gene name	Fc alpha receptor
Gene symbol	FCAR
Synonyms (NCBI Gene)	CD89CTB-61M7.2FcalphaRFcalphaRI
Chromosome	19
Chromosome location	19q13.42
Summary	This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eos

208

Show/Hide all (208)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019354	hsa-miR-148b-3p	Microarray	17612493
MIRT993690	hsa-miR-128	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993695	hsa-miR-3120-5p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993700	hsa-miR-3664-5p	CLIP-seq
MIRT993701	hsa-miR-3671	CLIP-seq
MIRT993702	hsa-miR-3672	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993705	hsa-miR-371-5p	CLIP-seq
MIRT993706	hsa-miR-371b-5p	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993708	hsa-miR-3926	CLIP-seq
MIRT993709	hsa-miR-4433	CLIP-seq
MIRT993710	hsa-miR-4459	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT993712	hsa-miR-4522	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993715	hsa-miR-4768-3p	CLIP-seq
MIRT993716	hsa-miR-4786-5p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993718	hsa-miR-548c-3p	CLIP-seq
MIRT993719	hsa-miR-548s	CLIP-seq
MIRT993690	hsa-miR-128	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993708	hsa-miR-3926	CLIP-seq
MIRT993720	hsa-miR-3929	CLIP-seq
MIRT993721	hsa-miR-4267	CLIP-seq
MIRT993722	hsa-miR-4419b	CLIP-seq
MIRT993709	hsa-miR-4433	CLIP-seq
MIRT993710	hsa-miR-4459	CLIP-seq
MIRT993723	hsa-miR-4478	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT993724	hsa-miR-455-5p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993715	hsa-miR-4768-3p	CLIP-seq
MIRT993716	hsa-miR-4786-5p	CLIP-seq
MIRT993725	hsa-miR-485-5p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993719	hsa-miR-548s	CLIP-seq
MIRT993726	hsa-miR-550a	CLIP-seq
MIRT993727	hsa-miR-890	CLIP-seq
MIRT993728	hsa-miR-122	CLIP-seq
MIRT993729	hsa-miR-1227	CLIP-seq
MIRT993730	hsa-miR-1273e	CLIP-seq
MIRT993731	hsa-miR-130a	CLIP-seq
MIRT993732	hsa-miR-130b	CLIP-seq
MIRT993733	hsa-miR-1827	CLIP-seq
MIRT993734	hsa-miR-301a	CLIP-seq
MIRT993735	hsa-miR-301b	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993736	hsa-miR-3135b	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993737	hsa-miR-3192	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993738	hsa-miR-3652	CLIP-seq
MIRT993739	hsa-miR-3665	CLIP-seq
MIRT993740	hsa-miR-3666	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993708	hsa-miR-3926	CLIP-seq
MIRT993741	hsa-miR-4252	CLIP-seq
MIRT993742	hsa-miR-4295	CLIP-seq
MIRT993743	hsa-miR-4430	CLIP-seq
MIRT993744	hsa-miR-454	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993745	hsa-miR-4736	CLIP-seq
MIRT993716	hsa-miR-4786-5p	CLIP-seq
MIRT993746	hsa-miR-4793-3p	CLIP-seq
MIRT993747	hsa-miR-490-3p	CLIP-seq
MIRT993748	hsa-miR-508-5p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993719	hsa-miR-548s	CLIP-seq
MIRT993749	hsa-miR-766	CLIP-seq
MIRT993750	hsa-miR-940	CLIP-seq
MIRT2228828	hsa-miR-1262	CLIP-seq
MIRT993690	hsa-miR-128	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993708	hsa-miR-3926	CLIP-seq
MIRT993709	hsa-miR-4433	CLIP-seq
MIRT993710	hsa-miR-4459	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT2228829	hsa-miR-4701-3p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993715	hsa-miR-4768-3p	CLIP-seq
MIRT993716	hsa-miR-4786-5p	CLIP-seq
MIRT993746	hsa-miR-4793-3p	CLIP-seq
MIRT993748	hsa-miR-508-5p	CLIP-seq
MIRT2228830	hsa-miR-542-3p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993719	hsa-miR-548s	CLIP-seq
MIRT2228831	hsa-miR-661	CLIP-seq
MIRT993749	hsa-miR-766	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993709	hsa-miR-4433	CLIP-seq
MIRT993710	hsa-miR-4459	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993715	hsa-miR-4768-3p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT2449582	hsa-miR-3675-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT2449583	hsa-miR-4684-5p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993718	hsa-miR-548c-3p	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993695	hsa-miR-3120-5p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT2532379	hsa-miR-3613-3p	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993700	hsa-miR-3664-5p	CLIP-seq
MIRT993701	hsa-miR-3671	CLIP-seq
MIRT993702	hsa-miR-3672	CLIP-seq
MIRT2449582	hsa-miR-3675-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993705	hsa-miR-371-5p	CLIP-seq
MIRT993706	hsa-miR-371b-5p	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993709	hsa-miR-4433	CLIP-seq
MIRT993710	hsa-miR-4459	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT993712	hsa-miR-4522	CLIP-seq
MIRT2449583	hsa-miR-4684-5p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993715	hsa-miR-4768-3p	CLIP-seq
MIRT993716	hsa-miR-4786-5p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993718	hsa-miR-548c-3p	CLIP-seq
MIRT2532380	hsa-miR-548n	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT2449582	hsa-miR-3675-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT2449583	hsa-miR-4684-5p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993718	hsa-miR-548c-3p	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002446	Process	Neutrophil mediated immunity	IDA	25339672
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25339672
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2258698
GO:0006955	Process	Immune response	TAS	10835685
GO:0016020	Component	Membrane	IEA
GO:0019766	Function	IgA receptor activity	IDA	25339672
GO:0019862	Function	IgA binding	IDA	25339672
GO:0019862	Function	IgA binding	IEA
GO:0033031	Process	Positive regulation of neutrophil apoptotic process	IDA	25339672
GO:0035457	Process	Cellular response to interferon-alpha	IDA	25339672
GO:0035579	Component	Specific granule membrane	TAS
GO:0038093	Process	Fc receptor signaling pathway	IDA	25339672
GO:0042119	Process	Neutrophil activation	IDA	25339672
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	25339672
GO:0071346	Process	Cellular response to type II interferon	IDA	25339672
GO:0071354	Process	Cellular response to interleukin-6	IDA	25339672
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	25339672
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	25339672
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS

MIM	HGNC	e!Ensembl
147045	3608	ENSG00000186431

P24071

Protein name

Immunoglobulin alpha Fc receptor (IgA Fc receptor) (CD antigen CD89)

Protein function

Binds to the Fc region of immunoglobulins alpha. Mediates several functions including cytokine production.

PDB

1OVZ , 1OW0 , 1UCT , 8SKU

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Isoform A.1, isoform A.2 and isoform A.3 are differentially expressed between blood and mucosal myeloid cells. Isoform A.1, isoform A.2 and isoform A.3 are expressed in monocytes. Isoform A.1 and isoform A.2 are expressed in alveolar m

Sequence

MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQL
MIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVT
GLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSL
GPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVA
LLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK

Sequence length

287

Interactions

View interactions

	KEGG		Reactome
	Phagosome Staphylococcus aureus infection		Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRANULOMATOSIS WITH POLYANGIITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (47)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	15140034		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	12430907		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	17178667, 31399060, 32278313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	12430907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	28736835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	29025244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	21116273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26812355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	2990780	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	17008591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	2990780	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	29025244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28736835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	17393381, 21116273, 27437939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	16928613, 20811333, 21116273, 8196290, 9367406, 9573548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32085673	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	22147912	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	14688376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10839814, 11776381, 20811333, 21116273, 21273231, 21750160, 27437939, 28672768, 9367406		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	2990780, 36232432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	40294794	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	38064228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	21116273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	21116273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	21116273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12110007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12110007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17339498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	25907714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26497517, 29855035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	39261750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12110007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	15559377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18409031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17008591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17008591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12393717, 16990604, 29296544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	30177023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	30216441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	30216441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	17033823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39780163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	11776381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29281010, 30995475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	17178667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19555692		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35909123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FCAR (Fc alpha receptor)