Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Other IDs Protein Associated diseases
Entrez ID	220323
Gene name	Out at first homolog
Gene symbol	OAF
Synonyms (NCBI Gene)	NS5ATP13TP2
Chromosome	11
Chromosome location	11q23.3

Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004880	hsa-miR-124-3p	Microarray	15685193
MIRT004880	hsa-miR-124-3p	Microarray	15685193
MIRT004880	hsa-miR-124-3p	Microarray	18668037
MIRT723402	hsa-miR-6736-3p	HITS-CLIP	19536157
MIRT723401	hsa-miR-6793-3p	HITS-CLIP	19536157
MIRT723400	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT723399	hsa-miR-1248	HITS-CLIP	19536157
MIRT723398	hsa-miR-9-5p	HITS-CLIP	19536157
MIRT723397	hsa-miR-4448	HITS-CLIP	19536157
MIRT723396	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT723395	hsa-miR-6844	HITS-CLIP	19536157
MIRT723402	hsa-miR-6736-3p	HITS-CLIP	19536157
MIRT723401	hsa-miR-6793-3p	HITS-CLIP	19536157
MIRT723400	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT723399	hsa-miR-1248	HITS-CLIP	19536157
MIRT723398	hsa-miR-9-5p	HITS-CLIP	19536157
MIRT723397	hsa-miR-4448	HITS-CLIP	19536157
MIRT723396	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT723395	hsa-miR-6844	HITS-CLIP	19536157
MIRT1200952	hsa-miR-1182	CLIP-seq
MIRT1200953	hsa-miR-1238	CLIP-seq
MIRT1200954	hsa-miR-1286	CLIP-seq
MIRT1200955	hsa-miR-1297	CLIP-seq
MIRT1200956	hsa-miR-1321	CLIP-seq
MIRT1200957	hsa-miR-143	CLIP-seq
MIRT1200958	hsa-miR-2110	CLIP-seq
MIRT1200959	hsa-miR-26a	CLIP-seq
MIRT1200960	hsa-miR-26b	CLIP-seq
MIRT1200961	hsa-miR-2909	CLIP-seq
MIRT1200962	hsa-miR-3175	CLIP-seq
MIRT1200963	hsa-miR-3202	CLIP-seq
MIRT1200964	hsa-miR-4271	CLIP-seq
MIRT1200965	hsa-miR-4419a	CLIP-seq
MIRT1200966	hsa-miR-4459	CLIP-seq
MIRT1200967	hsa-miR-4465	CLIP-seq
MIRT1200968	hsa-miR-4510	CLIP-seq
MIRT1200969	hsa-miR-4708-5p	CLIP-seq
MIRT1200970	hsa-miR-4718	CLIP-seq
MIRT1200971	hsa-miR-4722-5p	CLIP-seq
MIRT1200972	hsa-miR-4725-3p	CLIP-seq
MIRT1200973	hsa-miR-4728-3p	CLIP-seq
MIRT1200974	hsa-miR-4728-5p	CLIP-seq
MIRT1200975	hsa-miR-4739	CLIP-seq
MIRT1200976	hsa-miR-4747-5p	CLIP-seq
MIRT1200977	hsa-miR-4756-3p	CLIP-seq
MIRT1200978	hsa-miR-4756-5p	CLIP-seq
MIRT1200979	hsa-miR-4770	CLIP-seq
MIRT1200980	hsa-miR-4779	CLIP-seq
MIRT1200981	hsa-miR-576-3p	CLIP-seq
MIRT1200982	hsa-miR-580	CLIP-seq
MIRT1200954	hsa-miR-1286	CLIP-seq
MIRT1200956	hsa-miR-1321	CLIP-seq
MIRT1200962	hsa-miR-3175	CLIP-seq
MIRT2286509	hsa-miR-3194-3p	CLIP-seq
MIRT2286510	hsa-miR-3935	CLIP-seq
MIRT1200965	hsa-miR-4419a	CLIP-seq
MIRT1200966	hsa-miR-4459	CLIP-seq
MIRT1200968	hsa-miR-4510	CLIP-seq
MIRT2286511	hsa-miR-4685-5p	CLIP-seq
MIRT1200969	hsa-miR-4708-5p	CLIP-seq
MIRT1200971	hsa-miR-4722-5p	CLIP-seq
MIRT1200974	hsa-miR-4728-5p	CLIP-seq
MIRT1200975	hsa-miR-4739	CLIP-seq
MIRT1200978	hsa-miR-4756-5p	CLIP-seq
MIRT1200980	hsa-miR-4779	CLIP-seq
MIRT2286512	hsa-miR-508-5p	CLIP-seq
MIRT2286513	hsa-miR-516b	CLIP-seq
MIRT2391830	hsa-miR-1233	CLIP-seq
MIRT2391831	hsa-miR-129-3p	CLIP-seq
MIRT2391832	hsa-miR-1913	CLIP-seq
MIRT2391833	hsa-miR-3183	CLIP-seq
MIRT2391834	hsa-miR-324-3p	CLIP-seq
MIRT2391835	hsa-miR-4287	CLIP-seq
MIRT2391836	hsa-miR-4469	CLIP-seq
MIRT2391837	hsa-miR-4685-3p	CLIP-seq
MIRT2391838	hsa-miR-4723-3p	CLIP-seq
MIRT2391839	hsa-miR-4768-5p	CLIP-seq
MIRT2391840	hsa-miR-642a	CLIP-seq
MIRT2391841	hsa-miR-942	CLIP-seq

MIM	HGNC	e!Ensembl
621070	28752	ENSG00000184232

Q86UD1

Protein name

Out at first protein homolog (HCV NS5A-transactivated protein 13 target protein 2)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14941	OAF	30 → 268	Transcriptional regulator, Out at first	Family

Sequence

MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLE
LRKPDGTLVSFTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKL
RQKNPRAVRQAEEVRGLEHLHMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWL
EQGVDSSVFEALPKASEQAELPRCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSRDRPTP
YKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPG

Sequence length

273

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ectopia Lentis	Ectopia Lentis	BEFREE	29305299	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irido-corneo-trabecular dysgenesis (disorder)	Anterior segment dysgenesis	BEFREE	29305299	★★★★★ ★☆☆☆☆ Found in Text Mining only

OAF (out at first homolog)