DLEU7 (deleted in lymphocytic leukemia 7)

Gene

• Entrez ID: 220107
• Gene name: Deleted in lymphocytic leukemia 7
• Gene symbol: DLEU7
• Synonyms (NCBI Gene): -
• Chromosome: 13
• Chromosome location: 13q14.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT732742	hsa-miR-15b-3p	qRT-PCR	34277865
MIRT732743	hsa-miR-195-3p	qRT-PCR	34277865
MIRT938038	hsa-miR-130a	CLIP-seq
MIRT938039	hsa-miR-130b	CLIP-seq
MIRT938040	hsa-miR-148a	CLIP-seq
MIRT938041	hsa-miR-148b	CLIP-seq
MIRT938042	hsa-miR-152	CLIP-seq
MIRT938043	hsa-miR-19a	CLIP-seq
MIRT938044	hsa-miR-19b	CLIP-seq
MIRT938045	hsa-miR-301a	CLIP-seq
MIRT938046	hsa-miR-301b	CLIP-seq
MIRT938047	hsa-miR-3119	CLIP-seq
MIRT938048	hsa-miR-3185	CLIP-seq
MIRT938049	hsa-miR-3666	CLIP-seq
MIRT938050	hsa-miR-4276	CLIP-seq
MIRT938051	hsa-miR-4295	CLIP-seq
MIRT938052	hsa-miR-4325	CLIP-seq
MIRT938053	hsa-miR-4511	CLIP-seq
MIRT938054	hsa-miR-454	CLIP-seq
MIRT938055	hsa-miR-507	CLIP-seq
MIRT938056	hsa-miR-518a-5p	CLIP-seq
MIRT938057	hsa-miR-527	CLIP-seq
MIRT938058	hsa-miR-548ag	CLIP-seq
MIRT938059	hsa-miR-548ai	CLIP-seq
MIRT938060	hsa-miR-548m	CLIP-seq
MIRT938061	hsa-miR-557	CLIP-seq
MIRT938062	hsa-miR-599	CLIP-seq
MIRT1977603	hsa-miR-4452	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005575	Component	Cellular_component	ND
GO:0008150	Process	Biological_process	ND

Other IDs

• MIM: 618634
• HGNC: 17567
• e!Ensembl: ENSG00000186047

Protein

• UniProt ID: Q6UYE1
• Protein name: Leukemia-associated protein 7 (Deleted in lymphocytic leukemia 7)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15760	DLEU7	28 → 221	Leukemia-associated protein 7	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:14706829}.
• Sequence:

  MASPAPLVASISHQMVALQTLQLLQQEWGWGDGPVAPGNPRDPDHVSTAPARRSGPPRAR
  PGPGREERGGGVGTRSRRTAARANSPEEEVVRGAEGGAELLPFPRDRGPCTLAQMAMRSA
  LARVVDSTSELVSVEQTLLGPLQQERSFPIHLKDSVEFRNICSHLALQIEGQQFDRDLNA
  AHQCLKTIVKKLIQSLANFPSDAHMVACASLRQILQNLPDI

• Sequence length: 221

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	3487974		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	3487974		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36035305	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	11740050		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11740050		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20071661		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	3487974		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14706829, 20071661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29364477	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18054939		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30054458		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	10492040		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18054939		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35506368	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	35506368	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20071661	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29364477	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20071661		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14706829, 20071661, 27925298		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	27925298		★☆☆☆☆ Found in Text Mining only
Osteofibrous Dysplasia	Osteofibrous Dysplasia	BEFREE	11727265		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	22020760	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	10926322		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	2317110		★☆☆☆☆ Found in Text Mining only