Gene Gene information from NCBI Gene database.
Entrez ID 22
Gene name ATP binding cassette subfamily B member 7
Gene symbol ABCB7
Synonyms (NCBI Gene)
ABC7ASATAtm1pEST140535
Chromosome X
Chromosome location Xq13.3
Summary The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct
SNPs SNP information provided by dbSNP.
8
SNP ID Visualize variation Clinical significance Consequence
rs1133577 C>A,T Likely-pathogenic Coding sequence variant, missense variant
rs72554634 A>C,T Pathogenic Coding sequence variant, synonymous variant, missense variant
rs80356713 C>A,G Pathogenic Coding sequence variant, missense variant
rs80356714 C>T Pathogenic Coding sequence variant, missense variant
rs515726147 T>A Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
80
miRTarBase ID miRNA Experiments Reference
MIRT019397 hsa-miR-148b-3p Microarray 17612493
MIRT023677 hsa-miR-1-3p Proteomics 18668040
MIRT051202 hsa-miR-16-5p CLASH 23622248
MIRT050748 hsa-miR-17-3p CLASH 23622248
MIRT050056 hsa-miR-26a-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0005515 Function Protein binding IPI 25063848, 30765471
GO:0005524 Function ATP binding IEA
GO:0005524 Function ATP binding TAS 9621516
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300135 48 ENSG00000131269
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75027
Protein name Iron-sulfur clusters transporter ABCB7, mitochondrial (ATP-binding cassette sub-family B member 7, mitochondrial) (ATP-binding cassette transporter 7) (ABC transporter 7 protein)
Protein function Exports glutathione-coordinated iron-sulfur clusters such as [2Fe-2S]-(GS)4 cluster from the mitochondria to the cytosol in an ATP-dependent manner allowing the assembly of the cytosolic iron-sulfur (Fe/S) cluster-containing proteins and partici
PDB 7VGF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00664 ABC_membrane 140 424 ABC transporter transmembrane region Family
PF00005 ABC_tran 488 637 ABC transporter Domain
Sequence
MALLAMHSWRWAAAAAAFEKRRHSAILIRPLVSVSGSGPQWRPHQLGALGTARAYQIPES
LKSITWQRLGKGNSGQFLDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKI
IKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSD
APNTVATMATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGF
HLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGT
LGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYDGFL
KTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVLASQGIVAGTLTVGDLVMVNGLLFQL
SLPL
NFLGTVYRETRQALIDMNTLFTLLKVDTQIKDKVMASPLQITPQTATVAFDNVHFE
YIEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVS
LESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDT
QVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATS
SLDSITEETILGAMKDVVKHRTS
IFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKW
EAKKENISKEEERKKLQEEIVNSVKGCGNCSC
Sequence length 752
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  ABC transporters   Mitochondrial ABC transporters
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
37
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Nonpapillary renal cell carcinoma Likely pathogenic rs762876355 RCV005939494
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spinocerebellar ataxia, X-linked Likely pathogenic rs797044558 RCV000190539
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
X-linked sideroblastic anemia with ataxia Pathogenic; Likely pathogenic rs515726147, rs72554634, rs80356714, rs80356713, rs762876355, rs1057518042 RCV000114380
RCV000012330
RCV000012331
RCV000012332
RCV004547420
View all (2 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ABCB7-related disorder Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANEMIA, SIDEROBLASTIC CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anemia Anemia HPO_DG
★☆☆☆☆
Found in Text Mining only
Anemia Refractory Refractory anemia Pubtator 19692701, 23070040 Associate
★☆☆☆☆
Found in Text Mining only
Anemia Sideroblastic Sideroblastic anemia Pubtator 18398482, 26242992, 34861039, 36028755 Associate
★☆☆☆☆
Found in Text Mining only
Anemia sideroblastic spinocerebellar ataxia Sideroblastic anemia Pubtator 11050011, 17192393, 18398482, 30765471 Associate
★☆☆☆☆
Found in Text Mining only
ANEMIA, SIDEROBLASTIC, AND SPINOCEREBELLAR ATAXIA Anemia and spinocerebellar ataxia BEFREE 10196363, 11843825, 22398176, 28577724
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANEMIA, SIDEROBLASTIC, AND SPINOCEREBELLAR ATAXIA Anemia and spinocerebellar ataxia CLINVAR_DG 10196363, 22398176
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANEMIA, SIDEROBLASTIC, AND SPINOCEREBELLAR ATAXIA Anemia and spinocerebellar ataxia UNIPROT_DG 10196363, 11050011, 11843825, 22398176
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANEMIA, SIDEROBLASTIC, AND SPINOCEREBELLAR ATAXIA Anemia and spinocerebellar ataxia GENOMICS_ENGLAND_DG 11050011, 11843825, 29787825
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANEMIA, SIDEROBLASTIC, AND SPINOCEREBELLAR ATAXIA Anemia and spinocerebellar ataxia CTD_human_DG 21326867
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Ataxia Ataxia Pubtator 11843825, 26242992 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations