MPEG1 (macrophage expressed 1)

Gene

• Entrez ID: 219972
• Gene name: Macrophage expressed 1
• Gene symbol: MPEG1
• Synonyms (NCBI Gene): IMD77, MPG1, MPS1, Mpg-1, P-2
• Chromosome: 11
• Chromosome location: 11q12.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT722649	hsa-miR-8485	HITS-CLIP	19536157
MIRT722648	hsa-miR-3120-3p	HITS-CLIP	19536157
MIRT722647	hsa-miR-125a-3p	HITS-CLIP	19536157
MIRT722646	hsa-miR-4668-5p	HITS-CLIP	19536157
MIRT722645	hsa-miR-3153	HITS-CLIP	19536157
MIRT722644	hsa-miR-6733-5p	HITS-CLIP	19536157
MIRT722643	hsa-miR-6739-5p	HITS-CLIP	19536157
MIRT722642	hsa-miR-450a-1-3p	HITS-CLIP	19536157
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT626001	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT626000	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT625999	hsa-miR-1206	HITS-CLIP	23824327
MIRT625998	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT625997	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT625996	hsa-miR-4455	HITS-CLIP	23824327
MIRT625995	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT626001	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT626000	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT625999	hsa-miR-1206	HITS-CLIP	23824327
MIRT625998	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT625997	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT625996	hsa-miR-4455	HITS-CLIP	23824327
MIRT625995	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT625999	hsa-miR-1206	HITS-CLIP	27418678
MIRT625999	hsa-miR-1206	HITS-CLIP	27418678
MIRT625999	hsa-miR-1206	HITS-CLIP	27418678
MIRT625999	hsa-miR-1206	HITS-CLIP	27418678
MIRT625999	hsa-miR-1206	HITS-CLIP	27418678
MIRT626000	hsa-miR-124-5p	HITS-CLIP	27418678
MIRT626000	hsa-miR-124-5p	HITS-CLIP	27418678
MIRT626000	hsa-miR-124-5p	HITS-CLIP	27418678
MIRT626000	hsa-miR-124-5p	HITS-CLIP	27418678
MIRT626000	hsa-miR-124-5p	HITS-CLIP	27418678
MIRT625996	hsa-miR-4455	HITS-CLIP	27418678
MIRT625996	hsa-miR-4455	HITS-CLIP	27418678
MIRT625996	hsa-miR-4455	HITS-CLIP	27418678
MIRT625996	hsa-miR-4455	HITS-CLIP	27418678
MIRT625996	hsa-miR-4455	HITS-CLIP	27418678
MIRT625997	hsa-miR-5007-3p	HITS-CLIP	27418678
MIRT625997	hsa-miR-5007-3p	HITS-CLIP	27418678
MIRT625997	hsa-miR-5007-3p	HITS-CLIP	27418678
MIRT625997	hsa-miR-5007-3p	HITS-CLIP	27418678
MIRT625997	hsa-miR-5007-3p	HITS-CLIP	27418678
MIRT625995	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT625995	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT625995	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT625995	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT625995	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT625995	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT625998	hsa-miR-6853-3p	HITS-CLIP	27418678
MIRT625998	hsa-miR-6853-3p	HITS-CLIP	27418678
MIRT625998	hsa-miR-6853-3p	HITS-CLIP	27418678
MIRT625998	hsa-miR-6853-3p	HITS-CLIP	27418678
MIRT625998	hsa-miR-6853-3p	HITS-CLIP	27418678
MIRT626001	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT626001	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT626001	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT626001	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT626001	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT626001	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT722649	hsa-miR-8485	HITS-CLIP	19536157
MIRT722648	hsa-miR-3120-3p	HITS-CLIP	19536157
MIRT722647	hsa-miR-125a-3p	HITS-CLIP	19536157
MIRT722646	hsa-miR-4668-5p	HITS-CLIP	19536157
MIRT722645	hsa-miR-3153	HITS-CLIP	19536157
MIRT722644	hsa-miR-6733-5p	HITS-CLIP	19536157
MIRT722643	hsa-miR-6739-5p	HITS-CLIP	19536157
MIRT722642	hsa-miR-450a-1-3p	HITS-CLIP	19536157
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT626001	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT626000	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT625999	hsa-miR-1206	HITS-CLIP	23824327
MIRT625998	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT625997	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT625996	hsa-miR-4455	HITS-CLIP	23824327
MIRT625995	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT626001	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT626000	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT625999	hsa-miR-1206	HITS-CLIP	23824327
MIRT625998	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT625997	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT625996	hsa-miR-4455	HITS-CLIP	23824327
MIRT625995	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT619440	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT1155998	hsa-miR-1244	CLIP-seq
MIRT1155999	hsa-miR-1245b-3p	CLIP-seq
MIRT1156000	hsa-miR-1258	CLIP-seq
MIRT1156001	hsa-miR-1304	CLIP-seq
MIRT1156002	hsa-miR-153	CLIP-seq
MIRT1156003	hsa-miR-3202	CLIP-seq
MIRT1156004	hsa-miR-326	CLIP-seq
MIRT1156005	hsa-miR-330-5p	CLIP-seq
MIRT1156006	hsa-miR-335	CLIP-seq
MIRT1156007	hsa-miR-3914	CLIP-seq
MIRT1156008	hsa-miR-3934	CLIP-seq
MIRT1156009	hsa-miR-3942-3p	CLIP-seq
MIRT1156010	hsa-miR-4302	CLIP-seq
MIRT1156011	hsa-miR-4437	CLIP-seq
MIRT1156012	hsa-miR-448	CLIP-seq
MIRT1156013	hsa-miR-4533	CLIP-seq
MIRT1156014	hsa-miR-4709-3p	CLIP-seq
MIRT1156015	hsa-miR-548n	CLIP-seq
MIRT1156016	hsa-miR-593	CLIP-seq
MIRT1156017	hsa-miR-764	CLIP-seq
MIRT1156018	hsa-miR-890	CLIP-seq
MIRT2273827	hsa-miR-1287	CLIP-seq
MIRT2273828	hsa-miR-143	CLIP-seq
MIRT2273829	hsa-miR-204	CLIP-seq
MIRT2273830	hsa-miR-210	CLIP-seq
MIRT2273831	hsa-miR-211	CLIP-seq
MIRT2273832	hsa-miR-3135b	CLIP-seq
MIRT2273833	hsa-miR-3148	CLIP-seq
MIRT2273834	hsa-miR-3166	CLIP-seq
MIRT2273835	hsa-miR-4287	CLIP-seq
MIRT2273836	hsa-miR-4685-3p	CLIP-seq
MIRT2273837	hsa-miR-4712-3p	CLIP-seq
MIRT2273838	hsa-miR-4770	CLIP-seq
MIRT2273839	hsa-miR-4771	CLIP-seq
MIRT2273840	hsa-miR-544	CLIP-seq
MIRT2273841	hsa-miR-875-3p	CLIP-seq
MIRT1155999	hsa-miR-1245b-3p	CLIP-seq
MIRT1156001	hsa-miR-1304	CLIP-seq
MIRT1156009	hsa-miR-3942-3p	CLIP-seq
MIRT2454397	hsa-miR-1912	CLIP-seq
MIRT2454398	hsa-miR-711	CLIP-seq
MIRT2454397	hsa-miR-1912	CLIP-seq
MIRT2454398	hsa-miR-711	CLIP-seq
MIRT2454397	hsa-miR-1912	CLIP-seq
MIRT1156003	hsa-miR-3202	CLIP-seq
MIRT2572739	hsa-miR-3670	CLIP-seq
MIRT2572740	hsa-miR-3714	CLIP-seq
MIRT1156013	hsa-miR-4533	CLIP-seq
MIRT2572741	hsa-miR-4677-3p	CLIP-seq
MIRT2454398	hsa-miR-711	CLIP-seq
MIRT1156018	hsa-miR-890	CLIP-seq
MIRT2454397	hsa-miR-1912	CLIP-seq
MIRT2454398	hsa-miR-711	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002468	Process	Dendritic cell antigen processing and presentation	ISS
GO:0002478	Process	Antigen processing and presentation of exogenous peptide antigen	ISS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	IDA	9716645
GO:0005576	Component	Extracellular region	IEA
GO:0016020	Component	Membrane	IEA
GO:0022829	Function	Wide pore channel activity	IDA	31537793
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	ISS	37347855
GO:0031410	Component	Cytoplasmic vesicle	IDA	26402460
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042590	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I	ISS	37347855
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IMP	26402460, 33224153
GO:0045087	Process	Innate immune response	IEA
GO:0045335	Component	Phagocytic vesicle	ISS
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	23753625
GO:0050829	Process	Defense response to Gram-negative bacterium	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	30609079
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0061474	Component	Phagolysosome membrane	IDA	31537793
GO:0140367	Process	Antibacterial innate immune response	ISS

Other IDs

• MIM: 610390
• HGNC: 29619
• e!Ensembl: ENSG00000197629

Protein

• UniProt ID: Q2M385
• Protein name: Macrophage-expressed gene 1 protein (Macrophage gene 1 protein) (Mpg-1) (Perforin-2) (P-2) [Cleaved into: Macrophage-expressed gene 1 protein, processed form]
• Protein function: Pore-forming protein involved in both innate and adaptive immunity (PubMed:23753625, PubMed:26402460, PubMed:28422754, PubMed:30609079, PubMed:31537793, PubMed:33224153). Plays a central role in antigen cross-presentation in dendritic cells by f
• PDB: 6U23, 6U2J, 6U2K, 6U2L, 6U2W
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01823	MACPF	125 → 341	MAC/Perforin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed constitutively in a variety of cell types including macrophages, natural killer cells, neutrophils, keratinocytes and monocytes (PubMed:26402460, PubMed:28705375, PubMed:7888681). In skin, expressed in both hematopoietic and
• Sequence:

  MNNFRATILFWAAAAWAKSGKPSGEMDEVGVQKCKNALKLPVLEVLPGGGWDNLRNVDMG
  RVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELS
  LFSKVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISD
  RLENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASA
  GLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHL
  VAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNF
  QANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVH
  LLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFG
  GLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPL
  VDPAISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTRPP
  LMSQAATNTVIVTNSENARSWIKDSQTHQWRLGEPIELRRAMNVIHGDGGGLSGGAAAGV
  TVGVTTILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSPA

• Sequence length: 716

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Immunodeficiency 77	Pathogenic	rs761971524	RCV001338474	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary ciliary dyskinesia 3	Pathogenic	rs2496452431	RCV003234813	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Castleman-Kojima disease	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CILIARY DYSKINESIA, PRIMARY, 3	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MPEG1-related disorder	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MPEG1-related immunodeficiency	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA, ANASARCA, FEVER, RENAL INSUFFICIENCY, ORGANOMEGALY SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Medulloblastoma	Medulloblastoma	BEFREE	27633003		★☆☆☆☆ Found in Text Mining only
alpha-L-Iduronidase Deficiency	Mucopolysaccharidosis	BEFREE	19751987, 24411223		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	17927985		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24282275, 25137017		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31614249		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31614249		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35919038	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21402910, 28259529, 30693152		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31215439	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	39871215	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28619065		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	29148893		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	27633003		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30601084		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25063032, 29925769		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30854056, 31506433		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	18792977		★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	BEFREE	15194053		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	29143201		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	31467635		★☆☆☆☆ Found in Text Mining only
Fetal Diseases	Fetal Diseases	BEFREE	28379622		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	28721335		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23940287, 25722303, 25991676, 27819146, 30693152		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23940287, 25722303, 25991676, 27819146, 30693152		★☆☆☆☆ Found in Text Mining only
Hartnup Disease	Hartnup Disease	BEFREE	19751987, 24411223		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	33224153	Associate	★☆☆☆☆ Found in Text Mining only
Hurler-Scheie Syndrome	Hurler-Scheie Syndrome	BEFREE	28660346, 30575621		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	31614249		★☆☆☆☆ Found in Text Mining only
Inborn Errors of Metabolism	Inborn Errors Of Metabolism	BEFREE	31065277, 31473686		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28299790, 29925769		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	40311306	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	28759042		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21402910, 24462521, 28259529, 30693152		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28299790		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21796632, 23803695		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16864798, 25063032, 27819146, 28299790, 29736010, 30199249, 30693152, 30854056, 31121430		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25063032, 29925769		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	27633003		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22430208, 30854056		★☆☆☆☆ Found in Text Mining only
MPS III B	Mucopolysaccharidosis	BEFREE	29942826		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis I	Mucopolysaccharidosis	BEFREE	19751987, 24411223, 28619065, 28721335, 29310675		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis II	Mucopolysaccharidosis	BEFREE	27146977, 28660346		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis Type IIIA	Mucopolysaccharidosis	BEFREE	19690583, 19690584, 27718145, 28660346, 29046964, 29310675, 29735373, 30226843		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis, MPS-IV-A	Mucopolysaccharidosis	BEFREE	18546277, 26740238, 28538597, 30136169, 31452203, 31590383		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21889435		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22430208, 23940287, 24282275, 24462521, 25991676, 26398286, 26637805, 28334731, 29736010, 31506433		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28619065		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Diseases	Sphingomyelinase deficiency	BEFREE	28728811		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	12593606		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36528667	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24282275		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	12555239		★☆☆☆☆ Found in Text Mining only
Pfaundler-Hurler Syndrome	Pfaundler-Hurler Syndrome	BEFREE	16435198, 19751987, 24411223, 27146977, 28170539, 29128371, 29310675, 31065277, 31473686, 8664897		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	25197064		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	33224153	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	37032379	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	37443002	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	33224153	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19642098		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21796632, 23803695		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	38425243	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29805692		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26398286, 28539250, 31121430, 31575759		★☆☆☆☆ Found in Text Mining only