Gene Gene information from NCBI Gene database.
Entrez ID 219770
Gene name Gap junction protein delta 4
Gene symbol GJD4
Synonyms (NCBI Gene)
CX40.1
Chromosome 10
Chromosome location 10p11.21
Summary Connexins, such as GJD4, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin s
miRNA miRNA information provided by mirtarbase database.
38
miRTarBase ID miRNA Experiments Reference
MIRT1020023 hsa-miR-4252 CLIP-seq
MIRT1020024 hsa-miR-4419a CLIP-seq
MIRT1020025 hsa-miR-4459 CLIP-seq
MIRT1020026 hsa-miR-4510 CLIP-seq
MIRT1020027 hsa-miR-4779 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005243 Function Gap junction channel activity IBA
GO:0005886 Component Plasma membrane IEA
GO:0005921 Component Gap junction IEA
GO:0005922 Component Connexin complex IBA
GO:0005922 Component Connexin complex IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611922 23296 ENSG00000177291
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96KN9
Protein name Gap junction delta-4 protein (Connexin-40.1) (Cx40.1)
Protein function One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
PDB 8GN7 , 8GN8 , 8GNB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00029 Connexin 4 221 Connexin Family
Tissue specificity TISSUE SPECIFICITY: Expressed in pancreas, kidney, skeletal muscle, liver, placenta, and heart. {ECO:0000269|PubMed:12881038}.
Sequence
MEGVDLLGFLIITLNCNVTMVGKLWFVLTMLLRMLVIVLAGRPVYQDEQERFVCNTLQPG
CANVCYDVFSPVSHLRFWLIQGVCVLLPSAVFSVYVLHRGATLAALGPRRCPDPREPASG
QRRCPRPFGERGGLQVPDFSAGYIIHLLLRTLLEAAFGALHYFLFGFLAPKKFPCTRPPC
TGVVDCYVSRPTEKSLLMLFLWAVSALSFLLGLADLVCSLR
RRMRRRPGPPTSPSIRKQS
GASGHAEGRRTDEEGGREEEGAPAPPGARAGGEGAGSPRRTSRVSGHTKIPDEDESEVTS
SASEKLGRQPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSGAP
HLRARKSEWV
Sequence length 370
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Gap junction assembly
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Carcinoma Colorectal Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
Dysferlinopathy Dysferlinopathy Pubtator 27229680 Associate
★☆☆☆☆
Found in Text Mining only