Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	219670
Gene name	Enkurin, TRPC channel interacting protein
Gene symbol	ENKUR
Synonyms (NCBI Gene)	C10orf63CFAP106
Chromosome	10
Chromosome location	10p12.1
Summary	This gene encodes a protein that interacts with calmodulin and several transient receptor potential canonical cation channel proteins. The encoded protein may function as an adaptor to localize signal transduction machinery to calcium channels. Alternativ

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments
MIRT963528	hsa-miR-1178	CLIP-seq
MIRT963529	hsa-miR-1226	CLIP-seq
MIRT963530	hsa-miR-1254	CLIP-seq
MIRT963531	hsa-miR-1290	CLIP-seq
MIRT963532	hsa-miR-129-5p	CLIP-seq
MIRT963533	hsa-miR-1303	CLIP-seq
MIRT963534	hsa-miR-1911	CLIP-seq
MIRT963535	hsa-miR-3074-5p	CLIP-seq
MIRT963536	hsa-miR-3116	CLIP-seq
MIRT963537	hsa-miR-361-3p	CLIP-seq
MIRT963538	hsa-miR-3661	CLIP-seq
MIRT963539	hsa-miR-370	CLIP-seq
MIRT963540	hsa-miR-411	CLIP-seq
MIRT963541	hsa-miR-421	CLIP-seq
MIRT963542	hsa-miR-4684-5p	CLIP-seq
MIRT963543	hsa-miR-4709-5p	CLIP-seq
MIRT963544	hsa-miR-4711-3p	CLIP-seq
MIRT963545	hsa-miR-4713-5p	CLIP-seq
MIRT963546	hsa-miR-4724-3p	CLIP-seq
MIRT963547	hsa-miR-4733-3p	CLIP-seq
MIRT963548	hsa-miR-4797-5p	CLIP-seq
MIRT963549	hsa-miR-548p	CLIP-seq
MIRT963550	hsa-miR-628-5p	CLIP-seq
MIRT963551	hsa-miR-631	CLIP-seq
MIRT963552	hsa-miR-767-3p	CLIP-seq
MIRT963553	hsa-miR-942	CLIP-seq
MIRT1985609	hsa-miR-1	CLIP-seq
MIRT1985610	hsa-miR-206	CLIP-seq
MIRT1985611	hsa-miR-4446-5p	CLIP-seq
MIRT1985612	hsa-miR-4452	CLIP-seq
MIRT1985613	hsa-miR-4755-5p	CLIP-seq
MIRT1985614	hsa-miR-498	CLIP-seq
MIRT1985615	hsa-miR-613	CLIP-seq
MIRT1985616	hsa-miR-642a	CLIP-seq
MIRT2220072	hsa-miR-2053	CLIP-seq
MIRT2220073	hsa-miR-3132	CLIP-seq
MIRT2220074	hsa-miR-3185	CLIP-seq
MIRT2220075	hsa-miR-4328	CLIP-seq
MIRT2220076	hsa-miR-4422	CLIP-seq
MIRT2220077	hsa-miR-582-5p	CLIP-seq
MIRT2220078	hsa-miR-891b	CLIP-seq
MIRT963528	hsa-miR-1178	CLIP-seq
MIRT963535	hsa-miR-3074-5p	CLIP-seq
MIRT963538	hsa-miR-3661	CLIP-seq
MIRT963539	hsa-miR-370	CLIP-seq
MIRT2220077	hsa-miR-582-5p	CLIP-seq
MIRT963550	hsa-miR-628-5p	CLIP-seq
MIRT963551	hsa-miR-631	CLIP-seq
MIRT963552	hsa-miR-767-3p	CLIP-seq
MIRT2387422	hsa-miR-935	CLIP-seq
MIRT2448849	hsa-miR-3121-3p	CLIP-seq
MIRT2448850	hsa-miR-4659a-3p	CLIP-seq
MIRT2448851	hsa-miR-4659b-3p	CLIP-seq
MIRT2448852	hsa-miR-4691-5p	CLIP-seq
MIRT2448853	hsa-miR-4775	CLIP-seq
MIRT2448854	hsa-miR-590-3p	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	IBA
GO:0005879	Component	Axonemal microtubule	IDA	36191189
GO:0005879	Component	Axonemal microtubule	ISS
GO:0005929	Component	Cilium	IEA
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0036126	Component	Sperm flagellum	IEA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0061966	Process	Establishment of left/right asymmetry	IDA	29257953
GO:0061966	Process	Establishment of left/right asymmetry	IEA
GO:0097228	Component	Sperm principal piece	IEA
GO:0097728	Component	9+0 motile cilium	IEA
GO:0097729	Component	9+2 motile cilium	IDA	29257953
GO:0097729	Component	9+2 motile cilium	IEA
GO:0160112	Component	Axonemal B tubule inner sheath	IEA
GO:0160112	Component	Axonemal B tubule inner sheath	ISS

MIM	HGNC	e!Ensembl
611025	28388	ENSG00000151023

Q8TC29

Protein name

Enkurin

Protein function

Adapter that functions to localize a calcium-sensitive signal transduction machinery in sperm to a calcium-permeable ion channel (By similarity). Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia a

PDB

7UNG , 8J07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13864	Enkurin	152 → 248	Calmodulin-binding	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in airway epithelial cells. {ECO:0000269|PubMed:36191189}.

Sequence

MDPTCSSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPK
DFLKKHSKEKTLPPKKNFDRNVPKKPAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKK
PKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENL
KKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQRLEEEMKQLEHD
IGIIEKHKIIYIANNA

Sequence length

256

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GENERALIZED ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31417642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35414777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30947633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30947633, 35414777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	31417642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30947633, 31417642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31417642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	29257953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	29733335		★★★★★ ★☆☆☆☆ Found in Text Mining only

ENKUR (enkurin, TRPC channel interacting protein)