Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	2191
Gene name	Fibroblast activation protein alpha
Gene symbol	FAP
Synonyms (NCBI Gene)	DPPIVFAPAFAPalphaSIMP
Chromosome	2
Chromosome location	2q24.2
Summary	The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT756324	hsa-miR-329-5p	Luciferase reporter assayWestern blottingqRT-PCR	38459511
MIRT1548582	hsa-miR-4303	CLIP-seq
MIRT1548583	hsa-miR-4682	CLIP-seq
MIRT2227036	hsa-miR-1911	CLIP-seq
MIRT2227037	hsa-miR-27a	CLIP-seq
MIRT2227038	hsa-miR-27b	CLIP-seq
MIRT2227039	hsa-miR-4778-3p	CLIP-seq
MIRT2227040	hsa-miR-4797-5p	CLIP-seq
MIRT2227041	hsa-miR-513a-5p	CLIP-seq
MIRT2530843	hsa-miR-1236	CLIP-seq
MIRT2227036	hsa-miR-1911	CLIP-seq
MIRT2530844	hsa-miR-204	CLIP-seq
MIRT2530845	hsa-miR-211	CLIP-seq
MIRT2227037	hsa-miR-27a	CLIP-seq
MIRT2227038	hsa-miR-27b	CLIP-seq
MIRT2530846	hsa-miR-30a	CLIP-seq
MIRT2530847	hsa-miR-30b	CLIP-seq
MIRT2530848	hsa-miR-30c	CLIP-seq
MIRT2530849	hsa-miR-30d	CLIP-seq
MIRT2530850	hsa-miR-30e	CLIP-seq
MIRT2530851	hsa-miR-338-5p	CLIP-seq
MIRT2530852	hsa-miR-3545-3p	CLIP-seq
MIRT2530853	hsa-miR-4287	CLIP-seq
MIRT1548582	hsa-miR-4303	CLIP-seq
MIRT2530854	hsa-miR-4327	CLIP-seq
MIRT2530855	hsa-miR-4438	CLIP-seq
MIRT2530856	hsa-miR-4453	CLIP-seq
MIRT2530857	hsa-miR-4495	CLIP-seq
MIRT2530858	hsa-miR-4538	CLIP-seq
MIRT1548583	hsa-miR-4682	CLIP-seq
MIRT2530859	hsa-miR-4685-3p	CLIP-seq
MIRT2530860	hsa-miR-4753-3p	CLIP-seq
MIRT2530861	hsa-miR-4768-5p	CLIP-seq
MIRT2530862	hsa-miR-4773	CLIP-seq
MIRT2227039	hsa-miR-4778-3p	CLIP-seq
MIRT2227040	hsa-miR-4797-5p	CLIP-seq
MIRT2530863	hsa-miR-5095	CLIP-seq
MIRT2227041	hsa-miR-513a-5p	CLIP-seq
MIRT2530854	hsa-miR-4327	CLIP-seq
MIRT2530855	hsa-miR-4438	CLIP-seq
MIRT2530863	hsa-miR-5095	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
EGR1	Activation	20515787
EGR1	Repression	20515787

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0002020	Function	Protease binding	IPI	17317851
GO:0004175	Function	Endopeptidase activity	IDA	17317851
GO:0004252	Function	Serine-type endopeptidase activity	IDA	10593948
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005178	Function	Integrin binding	IPI	10455171
GO:0005515	Function	Protein binding	IPI	16651416, 21314817
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	17317851
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10593948
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	10455171
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	10455171
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	IMP	9065413
GO:0006915	Process	Apoptotic process	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0008233	Function	Peptidase activity	IDA	9688278, 10455171
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IDA	16651416
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IMP	9065413
GO:0008236	Function	Serine-type peptidase activity	NAS	7911242
GO:0008239	Function	Dipeptidyl-peptidase activity	IBA
GO:0008239	Function	Dipeptidyl-peptidase activity	IDA	10593948
GO:0008239	Function	Dipeptidyl-peptidase activity	IEA
GO:0008239	Function	Dipeptidyl-peptidase activity	NAS	7911242
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0010710	Process	Regulation of collagen catabolic process	IDA	10455171
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	IDA	16651416
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9065413
GO:0016787	Function	Hydrolase activity	IEA
GO:0030027	Component	Lamellipodium	IDA	9065413, 16651416
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0032587	Component	Ruffle membrane	NAS	10455171
GO:0042802	Function	Identical protein binding	IPI	9065413
GO:0042803	Function	Protein homodimerization activity	IDA	10455171
GO:0042995	Component	Cell projection	IEA
GO:0043542	Process	Endothelial cell migration	IDA	16651416
GO:0045177	Component	Apical part of cell	IEA
GO:0045178	Component	Basal part of cell	IEA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IDA	10593948
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0051917	Process	Regulation of fibrinolysis	IC	17317851
GO:0060244	Process	Negative regulation of cell proliferation involved in contact inhibition	IEA
GO:0060244	Process	Negative regulation of cell proliferation involved in contact inhibition	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0097325	Process	Melanocyte proliferation	IEA
GO:0097325	Process	Melanocyte proliferation	ISS
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	ISS
GO:1902362	Process	Melanocyte apoptotic process	IEA
GO:1902362	Process	Melanocyte apoptotic process	ISS
GO:1903054	Process	Negative regulation of extracellular matrix organization	IDA	10455171
GO:1905368	Component	Peptidase complex	IMP	9065413

MIM	HGNC	e!Ensembl
600403	3590	ENSG00000078098

Q12884

Protein name

Prolyl endopeptidase FAP (EC 3.4.21.26) (170 kDa melanoma membrane-bound gelatinase) (Dipeptidyl peptidase FAP) (EC 3.4.14.5) (Fibroblast activation protein alpha) (FAPalpha) (Gelatine degradation protease FAP) (EC 3.4.21.-) (Integral membrane serine prot

Protein function

Cell surface glycoprotein serine protease that participates in extracellular matrix degradation and involved in many cellular processes including tissue remodeling, fibrosis, wound healing, inflammation and tumor growth. Both plasma membrane and

PDB

1Z68 , 6Y0F , 9DVQ , 9DVR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00930	DPPIV_N	106 → 473	Dipeptidyl peptidase IV (DPP IV) N-terminal region	Family
PF00326	Peptidase_S9	553 → 759	Prolyl oligopeptidase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in adipose tissue. Expressed in the dermal fibroblasts in the fetal skin. Expressed in the granulation tissue of healing wounds and on reactive stromal fibroblast in epithelial cancers. Expressed in activated fibroblast-like

Sequence

MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPN
WISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSK
LWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPP
FQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYG
DEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVPVPAMIASSDYYFSWLTWVT
DERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGFFVSTPVFSYD
AISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGR
TDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQV
YGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQ
ITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVY
TERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNA
QVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD

Sequence length

760

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (26)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

FAP (fibroblast activation protein alpha)