PTK2B (protein tyrosine kinase 2 beta)

Gene

• Entrez ID: 2185
• Gene name: Protein tyrosine kinase 2 beta
• Gene symbol: PTK2B
• Synonyms (NCBI Gene): CADTK, CAKB, FADK2, FAK2, PKB, PTK, PYK2, RAFTK
• Chromosome: 8
• Chromosome location: 8p21.2
• Summary: This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006963	hsa-miR-23b-3p	Immunoblot	22745829
MIRT018928	hsa-miR-335-5p	Microarray	18185580
MIRT438433	hsa-miR-517a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT438432	hsa-miR-517c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT438433	hsa-miR-517a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT438432	hsa-miR-517c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT716875	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT716874	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT716873	hsa-miR-940	HITS-CLIP	19536157
MIRT716871	hsa-miR-4514	HITS-CLIP	19536157
MIRT716872	hsa-miR-4692	HITS-CLIP	19536157
MIRT716870	hsa-miR-3665	HITS-CLIP	19536157
MIRT716869	hsa-miR-4736	HITS-CLIP	19536157
MIRT006963	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	28262617
MIRT006963	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	28262617
MIRT716875	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT716874	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT716873	hsa-miR-940	HITS-CLIP	19536157
MIRT716871	hsa-miR-4514	HITS-CLIP	19536157
MIRT716872	hsa-miR-4692	HITS-CLIP	19536157
MIRT716870	hsa-miR-3665	HITS-CLIP	19536157
MIRT716869	hsa-miR-4736	HITS-CLIP	19536157
MIRT1273554	hsa-miR-3189-5p	CLIP-seq
MIRT1273555	hsa-miR-3664-3p	CLIP-seq
MIRT1273556	hsa-miR-4433	CLIP-seq
MIRT1273557	hsa-miR-4459	CLIP-seq
MIRT1273558	hsa-miR-4469	CLIP-seq
MIRT1273559	hsa-miR-4726-3p	CLIP-seq
MIRT1273560	hsa-miR-4758-3p	CLIP-seq
MIRT1273561	hsa-miR-4768-3p	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT1273563	hsa-miR-548a-5p	CLIP-seq
MIRT1273564	hsa-miR-548ab	CLIP-seq
MIRT1273565	hsa-miR-548ak	CLIP-seq
MIRT1273566	hsa-miR-548b-5p	CLIP-seq
MIRT1273567	hsa-miR-548c-5p	CLIP-seq
MIRT1273568	hsa-miR-548d-5p	CLIP-seq
MIRT1273569	hsa-miR-548h	CLIP-seq
MIRT1273570	hsa-miR-548i	CLIP-seq
MIRT1273571	hsa-miR-548j	CLIP-seq
MIRT1273572	hsa-miR-548w	CLIP-seq
MIRT1273573	hsa-miR-548y	CLIP-seq
MIRT1273574	hsa-miR-559	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2080456	hsa-miR-4651	CLIP-seq
MIRT2080457	hsa-miR-4659a-5p	CLIP-seq
MIRT2080458	hsa-miR-4659b-5p	CLIP-seq
MIRT2080459	hsa-miR-4722-3p	CLIP-seq
MIRT2080460	hsa-miR-4763-5p	CLIP-seq
MIRT2080461	hsa-miR-4769-3p	CLIP-seq
MIRT2080462	hsa-miR-491-5p	CLIP-seq
MIRT2080463	hsa-miR-517a	CLIP-seq
MIRT2080464	hsa-miR-517b	CLIP-seq
MIRT2080465	hsa-miR-517c	CLIP-seq
MIRT2080466	hsa-miR-608	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2306603	hsa-miR-3607-5p	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2306604	hsa-miR-4453	CLIP-seq
MIRT2306605	hsa-miR-4501	CLIP-seq
MIRT2306606	hsa-miR-4504	CLIP-seq
MIRT2306607	hsa-miR-4538	CLIP-seq
MIRT2080457	hsa-miR-4659a-5p	CLIP-seq
MIRT2080458	hsa-miR-4659b-5p	CLIP-seq
MIRT2080459	hsa-miR-4722-3p	CLIP-seq
MIRT2080460	hsa-miR-4763-5p	CLIP-seq
MIRT2080461	hsa-miR-4769-3p	CLIP-seq
MIRT2306608	hsa-miR-542-3p	CLIP-seq
MIRT2306609	hsa-miR-659	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2080456	hsa-miR-4651	CLIP-seq
MIRT2080462	hsa-miR-491-5p	CLIP-seq
MIRT2080466	hsa-miR-608	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2604308	hsa-miR-1225-3p	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2604309	hsa-miR-1321	CLIP-seq
MIRT2604310	hsa-miR-15a	CLIP-seq
MIRT2604311	hsa-miR-15b	CLIP-seq
MIRT2604312	hsa-miR-16	CLIP-seq
MIRT2604313	hsa-miR-195	CLIP-seq
MIRT2604314	hsa-miR-2355-5p	CLIP-seq
MIRT2604315	hsa-miR-3125	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT2604316	hsa-miR-3162-5p	CLIP-seq
MIRT2604317	hsa-miR-3200-5p	CLIP-seq
MIRT2604318	hsa-miR-3202	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2604319	hsa-miR-3616-3p	CLIP-seq
MIRT2604320	hsa-miR-3619-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2604321	hsa-miR-3916	CLIP-seq
MIRT2604322	hsa-miR-3921	CLIP-seq
MIRT2604323	hsa-miR-3943	CLIP-seq
MIRT2604324	hsa-miR-424	CLIP-seq
MIRT2604325	hsa-miR-4268	CLIP-seq
MIRT2604326	hsa-miR-4274	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2604327	hsa-miR-4303	CLIP-seq
MIRT2604328	hsa-miR-4313	CLIP-seq
MIRT2604329	hsa-miR-4435	CLIP-seq
MIRT2306604	hsa-miR-4453	CLIP-seq
MIRT2604330	hsa-miR-4475	CLIP-seq
MIRT2604331	hsa-miR-4476	CLIP-seq
MIRT2604332	hsa-miR-4519	CLIP-seq
MIRT2306607	hsa-miR-4538	CLIP-seq
MIRT2604333	hsa-miR-4645-5p	CLIP-seq
MIRT2604334	hsa-miR-4649-3p	CLIP-seq
MIRT2604335	hsa-miR-4653-5p	CLIP-seq
MIRT2604336	hsa-miR-4671-5p	CLIP-seq
MIRT2604337	hsa-miR-4673	CLIP-seq
MIRT2604338	hsa-miR-4711-5p	CLIP-seq
MIRT2604339	hsa-miR-4721	CLIP-seq
MIRT2604340	hsa-miR-4739	CLIP-seq
MIRT2604341	hsa-miR-4755-3p	CLIP-seq
MIRT2604342	hsa-miR-4756-5p	CLIP-seq
MIRT2604343	hsa-miR-4776-5p	CLIP-seq
MIRT2604344	hsa-miR-497	CLIP-seq
MIRT2306609	hsa-miR-659	CLIP-seq
MIRT2604345	hsa-miR-665	CLIP-seq
MIRT2604346	hsa-miR-942	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2604308	hsa-miR-1225-3p	CLIP-seq
MIRT2604309	hsa-miR-1321	CLIP-seq
MIRT2604310	hsa-miR-15a	CLIP-seq
MIRT2604311	hsa-miR-15b	CLIP-seq
MIRT2604312	hsa-miR-16	CLIP-seq
MIRT2604313	hsa-miR-195	CLIP-seq
MIRT2689055	hsa-miR-198	CLIP-seq
MIRT2604314	hsa-miR-2355-5p	CLIP-seq
MIRT2604316	hsa-miR-3162-5p	CLIP-seq
MIRT2604317	hsa-miR-3200-5p	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2604319	hsa-miR-3616-3p	CLIP-seq
MIRT2604320	hsa-miR-3619-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2604322	hsa-miR-3921	CLIP-seq
MIRT2604323	hsa-miR-3943	CLIP-seq
MIRT2604324	hsa-miR-424	CLIP-seq
MIRT2689056	hsa-miR-4267	CLIP-seq
MIRT2604325	hsa-miR-4268	CLIP-seq
MIRT2604326	hsa-miR-4274	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2604327	hsa-miR-4303	CLIP-seq
MIRT2604328	hsa-miR-4313	CLIP-seq
MIRT2604329	hsa-miR-4435	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2604330	hsa-miR-4475	CLIP-seq
MIRT2604332	hsa-miR-4519	CLIP-seq
MIRT2604333	hsa-miR-4645-5p	CLIP-seq
MIRT2604334	hsa-miR-4649-3p	CLIP-seq
MIRT2604335	hsa-miR-4653-5p	CLIP-seq
MIRT2604337	hsa-miR-4673	CLIP-seq
MIRT2604338	hsa-miR-4711-5p	CLIP-seq
MIRT2604339	hsa-miR-4721	CLIP-seq
MIRT2604340	hsa-miR-4739	CLIP-seq
MIRT2604341	hsa-miR-4755-3p	CLIP-seq
MIRT2604342	hsa-miR-4756-5p	CLIP-seq
MIRT2604343	hsa-miR-4776-5p	CLIP-seq
MIRT2604344	hsa-miR-497	CLIP-seq
MIRT2604345	hsa-miR-665	CLIP-seq
MIRT2604346	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001952	Process	Regulation of cell-matrix adhesion	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IMP	18765415
GO:0002040	Process	Sprouting angiogenesis	IEA
GO:0002040	Process	Sprouting angiogenesis	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002315	Process	Marginal zone B cell differentiation	IEA
GO:0002315	Process	Marginal zone B cell differentiation	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	ISS
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	8939945
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	7544443, 10518561
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	ISS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	8497321
GO:0005515	Function	Protein binding	IPI	8849729, 9020138, 10022914, 10521452, 10867021, 11149930, 15661758, 18086875, 19086031, 21357692, 31413325, 32707033, 32814053, 36931259, 38844957
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	19880522
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	7499242
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	18765415
GO:0005925	Component	Focal adhesion	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006468	Process	Protein phosphorylation	TAS	7529876
GO:0006915	Process	Apoptotic process	TAS	10880513
GO:0006968	Process	Cellular defense response	ISS
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007030	Process	Golgi organization	IEA
GO:0007165	Process	Signal transduction	TAS	7499242, 10867021
GO:0007166	Process	Cell surface receptor signaling pathway	IMP	8849729
GO:0007172	Process	Signal complex assembly	IEA
GO:0007172	Process	Signal complex assembly	TAS	7529876
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	15050747
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18765415
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10867021
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	15050747
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IMP	19086031
GO:0009967	Process	Positive regulation of signal transduction	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	21245381
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010758	Process	Regulation of macrophage chemotaxis	IEA
GO:0010758	Process	Regulation of macrophage chemotaxis	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0014069	Component	Postsynaptic density	ISS
GO:0014069	Component	Postsynaptic density	TAS	25707991
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017146	Component	NMDA selective glutamate receptor complex	ISS
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	7544443
GO:0030027	Component	Lamellipodium	IDA	18765415
GO:0030027	Component	Lamellipodium	IEA
GO:0030054	Component	Cell junction	IEA
GO:0030155	Process	Regulation of cell adhesion	IBA
GO:0030155	Process	Regulation of cell adhesion	IMP	19086031
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	18765415
GO:0030425	Component	Dendrite	ISS
GO:0030426	Component	Growth cone	ISS
GO:0030502	Process	Negative regulation of bone mineralization	IEA
GO:0030502	Process	Negative regulation of bone mineralization	ISS
GO:0030546	Function	Signaling receptor activator activity	ISS
GO:0030838	Process	Positive regulation of actin filament polymerization	IMP	18765415
GO:0030865	Process	Cortical cytoskeleton organization	IEA
GO:0030865	Process	Cortical cytoskeleton organization	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	8670418
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	ISS
GO:0035255	Function	Ionotropic glutamate receptor binding	ISS
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	9545257
GO:0042976	Process	Activation of Janus kinase activity	IMP	8670418
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19880522
GO:0043267	Process	Negative regulation of potassium ion transport	IDA	7544443
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0044297	Component	Cell body	ISS
GO:0045453	Process	Bone resorption	IEA
GO:0045453	Process	Bone resorption	ISS
GO:0045638	Process	Negative regulation of myeloid cell differentiation	IMP	15050747
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IMP	7544443
GO:0046330	Process	Positive regulation of JNK cascade	IMP	8670418
GO:0046777	Process	Protein autophosphorylation	TAS	8849729
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	21245381
GO:0048167	Process	Regulation of synaptic plasticity	TAS	25707991
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18765415
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0065003	Process	Protein-containing complex assembly	TAS	10867021
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	7544443
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947
GO:0071498	Process	Cellular response to fluid shear stress	IEA
GO:0086100	Process	Endothelin receptor signaling pathway	IMP	19086031
GO:0097440	Component	Apical dendrite	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099092	Component	Postsynaptic density, intracellular component	IEA
GO:0099151	Process	Regulation of postsynaptic density assembly	IEA
GO:0099602	Function	Neurotransmitter receptor regulator activity	ISS
GO:2000058	Process	Regulation of ubiquitin-dependent protein catabolic process	IDA	19880522
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	ISS
GO:2000538	Process	Positive regulation of B cell chemotaxis	IEA
GO:2000538	Process	Positive regulation of B cell chemotaxis	ISS

Other IDs

• MIM: 601212
• HGNC: 9612
• e!Ensembl: ENSG00000120899

Protein

• UniProt ID: Q14289
• Protein name: Protein-tyrosine kinase 2-beta (EC 2.7.10.2) (Calcium-dependent tyrosine kinase) (CADTK) (Calcium-regulated non-receptor proline-rich tyrosine kinase) (Cell adhesion kinase beta) (CAK-beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine
• Protein function: Non-receptor protein-tyrosine kinase that regulates reorganization of the actin cytoskeleton, cell polarization, cell migration, adhesion, spreading and bone remodeling. Plays a role in the regulation of the humoral immune response, and is requi
• PDB: 2LK4, 3CC6, 3ET7, 3FZO, 3FZP, 3FZR, 3FZS, 3FZT, 3GM1, 3GM2, 3GM3, 3H3C, 3U3F, 4EKU, 4H1J, 4H1M, 4R32, 4XEF, 4XEK, 4XEV, 5TO8, 5TOB, 6LF3, 7PLL, 8XOX, 8YGX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18038	FERM_N_2	39 → 137	FERM N-terminal domain	Domain
  PF00373	FERM_M	141 → 265	FERM central domain	Domain
  PF07714	PK_Tyr_Ser-Thr	425 → 679	Protein tyrosine and serine/threonine kinase	Domain
  PF03623	Focal_AT	870 → 1002	Focal adhesion targeting region	Domain

• Tissue specificity: TISSUE SPECIFICITY: Most abundant in the brain, with highest levels in amygdala and hippocampus. Low levels in kidney (at protein level). Also expressed in spleen and lymphocytes. {ECO:0000269|PubMed:7544443, ECO:0000269|PubMed:9545257}.
• Sequence:

  MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
  CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
  LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
  LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
  LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
  EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
  SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
  AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
  LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
  ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
  RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
  CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
  KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
  EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
  LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
  LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
  QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

• Sequence length: 1009

Pathways

KEGG:

Calcium signaling pathway
Chemokine signaling pathway
Phospholipase D signaling pathway
Natural killer cell mediated cytotoxicity
Leukocyte transendothelial migration
GnRH signaling pathway
Yersinia infection
Hepatitis B
Human cytomegalovirus infection
Human immunodeficiency virus 1 infection

Reactome:

Signal regulatory protein family interactions
VEGFA-VEGFR2 Pathway
Interleukin-2 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	15996933, 24850755		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27018341		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	15626738		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	1766258		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29620213, 30694771		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	23587524, 24176282, 29115618		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12097266, 31289489		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10741721, 28152510, 31630149		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	12060623, 22188814		★☆☆☆☆ Found in Text Mining only
Alveolar capillary dysplasia	Alveolar capillary dysplasia	Pubtator	38029923	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25114068, 26625115, 26680604, 28199971, 28650998, 30286791, 30297968, 30611996, 32192109, 33419465	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	26680604, 27080426, 30518596, 30626696		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	24162737, 29777097, 30617256, 31473137		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	24162737		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	32719259	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21228060		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	21228060	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	36334505	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	25993291	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25993291		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	31636720		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24045154, 29588416, 31110200		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17599731		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17963503	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30146725, 30260006		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17822324		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	19152963	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24045154, 29588416, 31110200		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30664154		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33747117	Associate	★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	29115618		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	31256143		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	21828127	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20888662, 26987289, 28992684, 29099789, 29257286, 29285175, 29286130, 29434943, 29485914, 29488156, 29556279, 29570671, 29928364, 29928421, 30116377, 30210588, 30211660, 30477146, 30655858, 30783438, 30864701, 30942438, 31115571, 31442237, 31547366		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	29709906		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29456672		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	19051289, 29484683	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22859931		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	34924185	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	27653874		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10441522, 11429232, 12244302, 12244303, 12569575, 14681726, 16049961, 21084382, 21203579, 22060274, 22710711, 23291984, 23499909, 24142406, 25928145, 26084289, 26330541, 28387904, 28396252, 28599470, 29133485, 29342447, 30154572, 31118051		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10441522, 15475931, 16457699, 16619501, 17299391, 17545584, 21278786, 25099615, 25648557, 25744065, 25928145, 26026468, 27081168, 27391337, 28198505, 29524295, 30154572, 30250159, 31118051, 33785524, 34136934, 34666190, 35905534, 36656380, 38531793, 39769193	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15353558, 23626817, 30536312	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20844931		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	27367190, 29920512, 36788083	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12918102, 17609269, 21533080, 22583868, 25741595, 26109807, 28347229, 29749446, 29992971, 31860631, 32271415, 34639072, 34708625, 35132819, 35383533, 35412944	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	29419396	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22859931		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29085504		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22722483, 23922106, 24659658, 30112033, 30365050		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37276925	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34771150, 35457111	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23139422, 25757764, 26790128	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	27367190		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	25137373	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	25137373	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	12796566	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	26931105	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	32322000	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	36169245	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31389591		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31894261	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29800735, 31075090		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29800735, 31075090		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	12060623, 22188814		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	15940637, 29387222		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30607007		★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	11882364		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23482887		★☆☆☆☆ Found in Text Mining only
Chronic Lymphoproliferative Disorder of NK-Cells	Lymphoproliferative Disorder Of Natural Killer Cells	BEFREE	19880494		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	24290217		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	27173130		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28555636		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30872746		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22728329, 30013659		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	33082554	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28745498, 29552187		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12115344, 27350731, 27716613, 28990068, 29257307, 30025541, 30365116, 32000660, 35294319, 35586809, 36302536	Associate	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	16600505		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 5	Cone-rod dystrophy	BEFREE	17377520		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21325635, 26313366, 29387222		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17885560, 21666110, 28112209, 30542471		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30344745, 30655739		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	28878137		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17963503, 29435116, 30335903		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	29677563		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	22575597		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	18253748		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	18253748, 29792909		★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	27676325		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23880101, 29122977, 29805536		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24507683, 38497391	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11782951, 23880101, 26465605, 29122977, 29805536, 30477146		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20943749, 30544451	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30651870		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19581418, 29696964, 30210342, 30928787, 31609623		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	38374020	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26465605, 29246323		★☆☆☆☆ Found in Text Mining only
Diabetic Polyneuropathies	Diabetic polyneuropathy	BEFREE	29533535		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31759996		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	22842493	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27658743		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	24467828	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29595187		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	25640355, 29595187, 31863623	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19074548	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29399113		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30477146, 31442237		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22919244, 30942438	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29463194	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	18075463		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	14636889		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31604805		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	36083487	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20888662		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	30287501		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29331278		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	15455398		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	15455398		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	32925281	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29342447		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	21325635		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	21325635		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	18253748, 29792909		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31680442		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	31680442	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10940516, 10958682, 12651906, 15782140, 15967096, 16150119, 20881009, 21602932, 25213694, 9799739		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12468535, 14655756, 16740698, 21602932, 22497886, 32705169, 34614303, 35087132	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15967096		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10940516, 10958682, 12651906, 15782140, 20881009, 21602932, 25213694, 9799739		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15720813, 16723503, 22745829, 24395351, 25433371, 26151295, 30296359, 35862252, 36204885	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15967096, 19509258, 20881009, 22745829, 26098895		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type V	Glycogen Storage Disease	BEFREE	30461220		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	36698245	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	33082554	Associate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	16600505		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	12119278		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23115635		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23115635	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	17885560, 21666110, 28112209		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	24704994, 30584986, 31838054		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	23642027	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	15996933, 23832765		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30744607		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28555636		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	24061149, 29260360, 31286327		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	11162573, 19581418, 21241768, 30110341		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29078297		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	34911614	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	14611643, 36862882	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18075463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	30229842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoinsulinaemia (disorder)	Hypoinsulinemia	BEFREE	29260360		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	27885243		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12495471, 19473970, 25889845	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	28556791		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25659487, 29633623, 31841211		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31755225		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28555636, 29312496, 30828070		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33660567	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18160431, 22403297, 24507683, 29207074, 31389668, 37409718	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	21590431		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	25137373		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30170375		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	31610006		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	28685447		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	24112608		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17272402		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	38382928	Inhibit	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	38134081	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	17885560		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	14976243, 23832765, 27018341, 30185437		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22207684, 23828551, 35440579, 9949179	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23393162	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23393162, 24850755, 27531894, 33592500, 37038247	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12135675, 12406902, 14604974, 14976243, 15626738, 16254134, 24850755, 27071307, 27531894, 29276026		★☆☆☆☆ Found in Text Mining only
Leukemia, Natural Killer Cell Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	19880494		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31252679		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11261840, 12361705, 17551499, 20707757, 22096562, 22618716, 23474367, 24960055, 29332411, 29992971, 30784932, 31442665, 31849449		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	25080058		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25080058, 35132819	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12361705, 17551499		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	10741721		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18507841, 22581436, 23922106, 24659658, 24938479	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18571765		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19919693	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19930834	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30572770		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	19930834	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27590500		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25648557	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	23603894, 35440579	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29729186		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15735908		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23115635		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10048975, 10441522, 11429232, 12244302, 12244303, 12569575, 14681726, 21084382, 21203579, 22710711, 23291984, 23499909, 24142406, 25928145, 26084289, 26330541, 28387904, 28599470, 29133485, 29342447, 30154572, 31118051		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30288056		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29085504		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29545895, 30840267		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22722483, 23922106, 24659658, 30112033, 30365050		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31252679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31765735		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11461904, 11850124, 15782140, 17083125, 17329398, 18336616, 18794150, 19106639, 22020565, 26261538, 29488612		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	19718025		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20428959, 31786865		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29353884, 31158464		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22859931		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11850124, 11882383, 15641016, 16288295, 19106639, 19216065, 19433066, 19925030, 20214616, 20522531, 20844931, 22188814, 23115635, 23922106, 24659658, 24894011, 25215588, 25376370, 26261538, 26387544, 28178656, 28379898, 28572720, 28659828, 29017516, 29130389, 29217540, 29295560, 29342447, 29455664, 29706964, 29844859, 29928328, 30425234, 30563079, 30643008, 31118051, 31262910, 31368612, 31432600		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	28945300		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29800735, 31075090		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22728329, 30013659		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18832579		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30250159		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	12060623, 22188814		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	17039417, 22212915	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	11828257		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11828257, 12499277, 19718025, 28708099		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	19718025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	22475322	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory dysfunction	Memory Disorders	BEFREE	30626696		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	20943749	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29666854		★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	18684863, 25107911	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10880513, 18515658, 36053135, 36322819	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18515658, 21316102, 25217697, 26387544, 26833980, 28282033, 30867372		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	24155968	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Emery Dreifuss	Emery dreifuss muscular dystrophy	Pubtator	36657019	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	19644139	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	14961028, 15050747, 15353126, 16487179, 24097630, 24176282, 27018341, 29342447, 29507701, 3276362, 9566916		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28378397, 28444132, 28453729, 29030392, 30017933		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	34275376	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30582216, 30834525		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31634779, 35196205	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10593857, 10700233, 10972292, 12119278, 12479697, 15677629, 15735908, 15968641, 16051596, 16457699, 17551499, 17906699, 18336616, 18651178, 19211844, 20842106, 21297943, 21602932, 22475322, 22618716, 22710711, 25217697, 26098895, 26330541, 27716613, 28231742, 28293832, 28387904, 28476657, 28730764, 29133485, 29175105, 29455664, 29562639, 29924958, 30344745, 30476103, 30546426, 30655739, 30784932, 30980038, 31002157, 31025369, 31118051, 31158464, 31252615, 31516586, 31546901, 31593451, 31636720, 9563568, 9799739		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	40191870	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	17898317	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17828307, 19211844, 30020827, 31682765		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19211844, 30020827	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30611996, 31639492		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	19815051, 30588264		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28987868		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	16600505		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22722483, 23922106, 24659658, 24894011, 29342447		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27307439, 29078297		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	26330541		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17963503, 37058031, 37788787	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	22532149	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30970221		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	32124937	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29428397, 31081900		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	17537919, 17581868		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	19244237, 40080935	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31081900		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37874452	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22994717, 32901863, 34884541, 34903122	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	24336158, 25893298		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	38321265	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23013730, 24523919, 27613122, 30523211, 31957818, 32373947, 34727985, 36335987	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31765735		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17895832		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12495471, 38521069	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15994200, 30609134		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29608948, 30925459, 30993592, 31811872		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	30640362	Associate	★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	27885243		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30362568		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34213019	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	11478917		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	11478917		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18401419		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	16600505		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	23626817	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27018341		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	15940637		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11461904, 15782140, 17083125, 17329398, 18336616, 18794150, 19106639, 22020565, 26261538, 29488612		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	11204274	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	29456672		★☆☆☆☆ Found in Text Mining only
Prostatic Hypertrophy	Prostatic Hypertrophy	BEFREE	29603556		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11204274, 11461904, 14985354, 17329398, 18959755, 19106639, 35387563, 35908886, 37501932, 38048859	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17329398, 17563746, 18794150		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	22218591	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	38178680	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	30288056		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30344745, 30655739, 31002126		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	32225123	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29098028		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32323827	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17599731, 17963503		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	9621077	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	19051289	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	29214423		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	28884475		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	17524560, 29720235	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	22842493		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	11752813		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	19718025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12356726, 16170339, 17906699		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	17906699		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12097266, 28945300		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29339720, 31516586		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23730900, 25405202, 29039443, 31115008	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30707166		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17549376, 22576800, 23730900, 31100640, 9563568		★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	19718025		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	16600505		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	16600505		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29525610, 31604805		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	28556791		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20428959, 31786865		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19238332, 20428959, 23321169, 25099615, 25338767, 30274346, 30591093, 31786865, 36438913, 37415737, 40082221	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37953442	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26539501, 30211660		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28884475, 29720235		★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	21666110		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	GWASCAT_DG	30498034		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	29782321		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	35456471	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	28709620		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31646573, 31696481	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29353884, 31158464		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31158464		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32812852, 34911834	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27793840, 28387904, 29920512, 29924958, 30250159, 30363988, 31464004		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29920512, 30250159, 37657065	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	15455398		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31210320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21523767, 22486221, 29665744	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29516642, 34858519, 35616137, 35791307, 36253980, 36606668	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	29113583		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	22842493		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	22842493	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	34961976, 36797040	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thrombosis	Venous thrombosis	Pubtator	37391801	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	24410795, 31941556	Associate	★☆☆☆☆ Found in Text Mining only