FABP6 (fatty acid binding protein 6)

Gene

• Entrez ID: 2172
• Gene name: Fatty acid binding protein 6
• Gene symbol: FABP6
• Synonyms (NCBI Gene): I-15P, I-BABP, I-BALB, I-BAP, ILBP, ILBP3, ILLBP
• Chromosome: 5
• Chromosome location: 5q33.3
• Summary: This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016870	hsa-miR-335-5p	Microarray	18185580

Transcription factors

Transcription factor	Regulation	Reference
NR1H4	Activation	10514450
SP1	Unknown	11684682
SREBF1	Unknown	11684682
SREBF2	Unknown	11684682

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005504	Function	Fatty acid binding	IBA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	7588781
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	NAS	9250612
GO:0006869	Process	Lipid transport	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9250612
GO:0008289	Function	Lipid binding	IEA
GO:0008289	Function	Lipid binding	TAS	7588781
GO:0015908	Process	Fatty acid transport	IBA
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 600422
• HGNC: 3561
• e!Ensembl: ENSG00000170231

Protein

• UniProt ID: P51161
• Protein name: Gastrotropin (GT) (Fatty acid-binding protein 6) (Ileal lipid-binding protein) (ILBP) (Intestinal 15 kDa protein) (I-15P) (Intestinal bile acid-binding protein) (I-BABP)
• Protein function: Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes (By similarity). In vitro binds to bile acids in the order: deoxychol
• PDB: 1O1U, 1O1V, 2MM3, 5L8I, 5L8N, 5L8O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14651	Lipocalin_7	1 → 128		Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is xpressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. Isoform
• Sequence:

  MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTM
  TNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTY
  ERVSKRLA

• Sequence length: 128

Pathways

KEGG:

PPAR signaling pathway

Reactome:

Recycling of bile acids and salts
Triglyceride catabolism
NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	17909007		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	16951225		★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	BEFREE	18510604		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	19174784		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	19174784	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32191631, 34745496	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26831905	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	16237211		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	16237211		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	19995447	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	26609171		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32640984	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16951225, 17909007, 28689989, 30193961, 31651326		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16951225		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31651326, 36033394	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17266179, 19744871		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	19174784		★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	16237211	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	19319892	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16951225		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31593867		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	16472592		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31651326		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34499727	Associate	★☆☆☆☆ Found in Text Mining only