FABP3 (fatty acid binding protein 3)

Gene

• Entrez ID: 2170
• Gene name: Fatty acid binding protein 3
• Gene symbol: FABP3
• Synonyms (NCBI Gene): FABP11, H-FABP, M-FABP, MDGI, O-FABP
• Chromosome: 1
• Chromosome location: 1p35.2
• Summary: The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007213	hsa-miR-1-3p	ELISA, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	23141496
MIRT477175	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT477174	hsa-miR-5680	PAR-CLIP	23592263
MIRT477173	hsa-miR-3125	PAR-CLIP	23592263
MIRT477172	hsa-miR-3916	PAR-CLIP	23592263
MIRT477171	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT477170	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT477169	hsa-miR-1827	PAR-CLIP	23592263
MIRT477168	hsa-miR-4785	PAR-CLIP	23592263
MIRT477167	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT477166	hsa-miR-4663	PAR-CLIP	23592263
MIRT477165	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT477164	hsa-miR-8077	PAR-CLIP	23592263
MIRT477162	hsa-miR-3907	PAR-CLIP	23592263
MIRT477163	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT477175	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT477174	hsa-miR-5680	PAR-CLIP	23592263
MIRT477173	hsa-miR-3125	PAR-CLIP	23592263
MIRT477172	hsa-miR-3916	PAR-CLIP	23592263
MIRT477171	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT477170	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT477169	hsa-miR-1827	PAR-CLIP	23592263
MIRT477168	hsa-miR-4785	PAR-CLIP	23592263
MIRT477167	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT477166	hsa-miR-4663	PAR-CLIP	23592263
MIRT477165	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT477164	hsa-miR-8077	PAR-CLIP	23592263
MIRT477162	hsa-miR-3907	PAR-CLIP	23592263
MIRT477163	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT974901	hsa-miR-1207-3p	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT974903	hsa-miR-18a	CLIP-seq
MIRT974904	hsa-miR-18b	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT974907	hsa-miR-383	CLIP-seq
MIRT974908	hsa-miR-3920	CLIP-seq
MIRT974909	hsa-miR-4438	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT974911	hsa-miR-4735-3p	CLIP-seq
MIRT974912	hsa-miR-4772-5p	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq
MIRT1988847	hsa-miR-192	CLIP-seq
MIRT1988848	hsa-miR-215	CLIP-seq
MIRT2223235	hsa-miR-4795-3p	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT2449058	hsa-miR-4432	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT2449059	hsa-miR-548an	CLIP-seq
MIRT2449060	hsa-miR-642b	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq
MIRT2449059	hsa-miR-548an	CLIP-seq
MIRT2527108	hsa-miR-1244	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT2527109	hsa-miR-1293	CLIP-seq
MIRT2527110	hsa-miR-148a	CLIP-seq
MIRT2527111	hsa-miR-148b	CLIP-seq
MIRT2527112	hsa-miR-152	CLIP-seq
MIRT1988847	hsa-miR-192	CLIP-seq
MIRT1988848	hsa-miR-215	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT2527113	hsa-miR-3194-3p	CLIP-seq
MIRT2527114	hsa-miR-3663-3p	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT2449058	hsa-miR-4432	CLIP-seq
MIRT2527115	hsa-miR-4483	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT2527116	hsa-miR-4709-5p	CLIP-seq
MIRT2527117	hsa-miR-4802-5p	CLIP-seq
MIRT2527118	hsa-miR-545	CLIP-seq
MIRT2449059	hsa-miR-548an	CLIP-seq
MIRT2527119	hsa-miR-579	CLIP-seq
MIRT2527120	hsa-miR-591	CLIP-seq
MIRT2449060	hsa-miR-642b	CLIP-seq
MIRT2527121	hsa-miR-760	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq
MIRT2527108	hsa-miR-1244	CLIP-seq
MIRT974902	hsa-miR-1290	CLIP-seq
MIRT2527110	hsa-miR-148a	CLIP-seq
MIRT2527111	hsa-miR-148b	CLIP-seq
MIRT2527112	hsa-miR-152	CLIP-seq
MIRT974905	hsa-miR-3167	CLIP-seq
MIRT974906	hsa-miR-3677-3p	CLIP-seq
MIRT2449058	hsa-miR-4432	CLIP-seq
MIRT974910	hsa-miR-4698	CLIP-seq
MIRT2527116	hsa-miR-4709-5p	CLIP-seq
MIRT2527117	hsa-miR-4802-5p	CLIP-seq
MIRT2527118	hsa-miR-545	CLIP-seq
MIRT2527119	hsa-miR-579	CLIP-seq
MIRT2527120	hsa-miR-591	CLIP-seq
MIRT2449060	hsa-miR-642b	CLIP-seq
MIRT974913	hsa-miR-876-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IEA
GO:0005504	Function	Fatty acid binding	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 32296183
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IDA	23141496
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS	23873799
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0008092	Function	Cytoskeletal protein binding	IPI	17987659
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	7962070
GO:0008289	Function	Lipid binding	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0015909	Process	Long-chain fatty acid transport	IBA
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0015909	Process	Long-chain fatty acid transport	ISS	10224224
GO:0016528	Component	Sarcoplasm	IEA
GO:0032365	Process	Intracellular lipid transport	IEA
GO:0032365	Process	Intracellular lipid transport	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0036041	Function	Long-chain fatty acid binding	IBA
GO:0036041	Function	Long-chain fatty acid binding	IDA	3421901
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0046320	Process	Regulation of fatty acid oxidation	IEA
GO:0046320	Process	Regulation of fatty acid oxidation	ISS
GO:0050543	Function	Icosatetraenoic acid binding	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0055091	Process	Phospholipid homeostasis	IEA
GO:0055091	Process	Phospholipid homeostasis	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070538	Function	Oleic acid binding	IDA	3421901
GO:0070542	Process	Response to fatty acid	IEA
GO:0071073	Process	Positive regulation of phospholipid biosynthetic process	IC	3421901
GO:0140214	Process	Positive regulation of long-chain fatty acid import into cell	IEA
GO:0140214	Process	Positive regulation of long-chain fatty acid import into cell	ISS	10224224
GO:2001245	Process	Regulation of phosphatidylcholine biosynthetic process	IEA

Other IDs

• MIM: 134651
• HGNC: 3557
• e!Ensembl: ENSG00000121769

Protein

• UniProt ID: P05413
• Protein name: Fatty acid-binding protein, heart (Fatty acid-binding protein 3) (Heart-type fatty acid-binding protein) (H-FABP) (Mammary-derived growth inhibitor) (MDGI) (Muscle fatty acid-binding protein) (M-FABP)
• Protein function: FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
• PDB: 1G5W, 1HMR, 1HMS, 1HMT, 2HMB, 3RSW, 3WBG, 3WVM, 3WXQ, 4TJZ, 4TKB, 4TKH, 4TKJ, 4WBK, 5B27, 5B28, 5B29, 5CE4, 5HZ9, 6AQ1, 7EGO, 7EUV, 7EUW, 7FBF, 7FBM, 7FBN, 7FC4, 7FCG, 7FCX, 7FD7, 7FDT, 7FDU, 7FDX, 7FEK, 7FEU, 7FEZ, 7FF6, 7FFK, 7FFX, 7FG1, 7FG5, 7FZQ, 7V2G, 7V5U, 7VB1, 7WCI, 7WD6, 7WDJ, 7WE5, 7WF0, 7WJ1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00061	Lipocalin	6 → 132	Lipocalin / cytosolic fatty-acid binding protein family	Domain

• Sequence:

  MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
  TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
  GTAVCTRTYEKEA

• Sequence length: 133

Pathways

KEGG:

PPAR signaling pathway

Reactome:

Triglyceride catabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	18460953		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	27565197		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	31765454		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17289870		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15459486		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31765454		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	26891180		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37454217, 40033432	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37801139	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29133274		★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	27250500	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29255351		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	21535886	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29255351		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28807550		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28807550	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32315296	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	34798808	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	35584575	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	25027319		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	24493698		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10544950, 10945951, 8661024, 8895735, 9683796, 9815609		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25287138, 32377505	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15459486		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31828095	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30592062		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32041617	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23823803		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	21535886	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23510163, 28911997, 29133274, 29255351, 31172970		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23510163, 32041617	Associate	★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	BEFREE	28516430		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	31765454		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	28515017		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30988249		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28516430		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	23823803		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29239349		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26980771, 28077344, 28683166, 29255351, 30258183, 30862807		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28683166, 30258183, 30862807		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28683166, 30258183, 30862807		★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	32184430	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	26891180		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28846666, 32365792	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21535886, 32041617	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29866478		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12872269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	37355664	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	28077344		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	39510044	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15068254		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	15068254		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32707495, 35568702	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	18437121		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	23823803		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	24899611	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	16026778		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17721027, 25830762	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	22701570, 24899611	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	37277809, 40033432	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28349667		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18437121, 23337395, 31327702		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	Pubtator	21535886	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25263561	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28516430		★☆☆☆☆ Found in Text Mining only
Intracranial Thrombosis	Intracranial thrombosis	Pubtator	26081026	Associate	★☆☆☆☆ Found in Text Mining only
Iron-Refractory Iron Deficiency Anemia	Anemia	BEFREE	29133274		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31288580		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	28643014		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	23178314	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	28750675		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	28643014		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	28127194	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	27864793	Associate	★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	17721027	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27323829	Stimulate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	28222113	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24493698		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10544950, 10945951, 8661024, 8895735, 9683796, 9815609		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31746108		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	7757968, 8661024, 8895735, 9683796, 9815609		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22570344		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23510163	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23510163		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	18412949		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26212703	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28189274, 28650717, 30735072, 31172970		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	LHGDN	18021874		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	26980771, 28077344, 29255351		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	CTD_human_DG	18308699		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	15459486, 24493698, 7757968, 8661024, 8895735, 9242429, 9683796, 9815609		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15068254		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	23144710		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17721027	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21501347		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29065800	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	18469019		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27806724	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24855640, 28750675, 30930168, 31661838		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	25027319		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	26891180		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28516430		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28643014		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	25027319, 26792082		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31288580		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36478991	Associate	★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	28683166		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15459486		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37036489	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21535886	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32377505	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21767383	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	22570344		★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	23823803		★☆☆☆☆ Found in Text Mining only