Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2169
Gene name	Fatty acid binding protein 2
Gene symbol	FABP2
Synonyms (NCBI Gene)	FABPII-FABP
Chromosome	4
Chromosome location	4q26
Summary	The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and p

137

Show/Hide all (137)

miRTarBase ID	miRNA	Experiments	Reference
MIRT540734	hsa-miR-3667-5p	PAR-CLIP	21572407
MIRT540733	hsa-miR-451b	PAR-CLIP	21572407
MIRT540732	hsa-miR-3675-3p	PAR-CLIP	21572407
MIRT540731	hsa-miR-520f-5p	PAR-CLIP	21572407
MIRT540730	hsa-miR-4696	PAR-CLIP	21572407
MIRT540734	hsa-miR-3667-5p	PAR-CLIP	21572407
MIRT540733	hsa-miR-451b	PAR-CLIP	21572407
MIRT540732	hsa-miR-3675-3p	PAR-CLIP	21572407
MIRT540731	hsa-miR-520f-5p	PAR-CLIP	21572407
MIRT540730	hsa-miR-4696	PAR-CLIP	21572407
MIRT540734	hsa-miR-3667-5p	PAR-CLIP	21572407
MIRT540733	hsa-miR-451b	PAR-CLIP	21572407
MIRT540732	hsa-miR-3675-3p	PAR-CLIP	21572407
MIRT540731	hsa-miR-520f-5p	PAR-CLIP	21572407
MIRT540730	hsa-miR-4696	PAR-CLIP	21572407
MIRT540734	hsa-miR-3667-5p	PAR-CLIP	27292025
MIRT540734	hsa-miR-3667-5p	PAR-CLIP	27292025
MIRT540734	hsa-miR-3667-5p	PAR-CLIP	27292025
MIRT540734	hsa-miR-3667-5p	PAR-CLIP	27292025
MIRT540732	hsa-miR-3675-3p	PAR-CLIP	27292025
MIRT540732	hsa-miR-3675-3p	PAR-CLIP	27292025
MIRT540732	hsa-miR-3675-3p	PAR-CLIP	27292025
MIRT540732	hsa-miR-3675-3p	PAR-CLIP	27292025
MIRT540733	hsa-miR-451b	PAR-CLIP	27292025
MIRT540733	hsa-miR-451b	PAR-CLIP	27292025
MIRT540733	hsa-miR-451b	PAR-CLIP	27292025
MIRT540733	hsa-miR-451b	PAR-CLIP	27292025
MIRT540730	hsa-miR-4696	PAR-CLIP	27292025
MIRT540730	hsa-miR-4696	PAR-CLIP	27292025
MIRT540730	hsa-miR-4696	PAR-CLIP	27292025
MIRT540730	hsa-miR-4696	PAR-CLIP	27292025
MIRT540731	hsa-miR-520f-5p	PAR-CLIP	27292025
MIRT540731	hsa-miR-520f-5p	PAR-CLIP	27292025
MIRT540731	hsa-miR-520f-5p	PAR-CLIP	27292025
MIRT540731	hsa-miR-520f-5p	PAR-CLIP	27292025
MIRT540734	hsa-miR-3667-5p	PAR-CLIP	21572407
MIRT540733	hsa-miR-451b	PAR-CLIP	21572407
MIRT540732	hsa-miR-3675-3p	PAR-CLIP	21572407
MIRT540731	hsa-miR-520f-5p	PAR-CLIP	21572407
MIRT540730	hsa-miR-4696	PAR-CLIP	21572407
MIRT540734	hsa-miR-3667-5p	PAR-CLIP	21572407
MIRT540733	hsa-miR-451b	PAR-CLIP	21572407
MIRT540732	hsa-miR-3675-3p	PAR-CLIP	21572407
MIRT540731	hsa-miR-520f-5p	PAR-CLIP	21572407
MIRT540730	hsa-miR-4696	PAR-CLIP	21572407
MIRT540734	hsa-miR-3667-5p	PAR-CLIP	21572407
MIRT540733	hsa-miR-451b	PAR-CLIP	21572407
MIRT540732	hsa-miR-3675-3p	PAR-CLIP	21572407
MIRT540731	hsa-miR-520f-5p	PAR-CLIP	21572407
MIRT540730	hsa-miR-4696	PAR-CLIP	21572407
MIRT974860	hsa-miR-1245b-3p	CLIP-seq
MIRT974861	hsa-miR-1273e	CLIP-seq
MIRT974862	hsa-miR-1285	CLIP-seq
MIRT974863	hsa-miR-1304	CLIP-seq
MIRT974864	hsa-miR-1587	CLIP-seq
MIRT974865	hsa-miR-1827	CLIP-seq
MIRT974866	hsa-miR-3140-5p	CLIP-seq
MIRT974867	hsa-miR-3163	CLIP-seq
MIRT974868	hsa-miR-3187-5p	CLIP-seq
MIRT974869	hsa-miR-3611	CLIP-seq
MIRT974870	hsa-miR-3973	CLIP-seq
MIRT974871	hsa-miR-4272	CLIP-seq
MIRT974872	hsa-miR-4282	CLIP-seq
MIRT974873	hsa-miR-4293	CLIP-seq
MIRT974874	hsa-miR-4302	CLIP-seq
MIRT974875	hsa-miR-4330	CLIP-seq
MIRT974876	hsa-miR-4427	CLIP-seq
MIRT974877	hsa-miR-4433	CLIP-seq
MIRT974878	hsa-miR-4459	CLIP-seq
MIRT974879	hsa-miR-4492	CLIP-seq
MIRT974880	hsa-miR-4498	CLIP-seq
MIRT974881	hsa-miR-4501	CLIP-seq
MIRT974882	hsa-miR-4640-3p	CLIP-seq
MIRT974883	hsa-miR-4656	CLIP-seq
MIRT974884	hsa-miR-4675	CLIP-seq
MIRT974885	hsa-miR-4722-5p	CLIP-seq
MIRT974886	hsa-miR-4741	CLIP-seq
MIRT974887	hsa-miR-4765	CLIP-seq
MIRT974888	hsa-miR-4793-5p	CLIP-seq
MIRT974889	hsa-miR-4796-3p	CLIP-seq
MIRT974890	hsa-miR-499-3p	CLIP-seq
MIRT974891	hsa-miR-499a-3p	CLIP-seq
MIRT974892	hsa-miR-520g	CLIP-seq
MIRT974893	hsa-miR-520h	CLIP-seq
MIRT974894	hsa-miR-582-5p	CLIP-seq
MIRT974895	hsa-miR-610	CLIP-seq
MIRT974896	hsa-miR-612	CLIP-seq
MIRT974897	hsa-miR-661	CLIP-seq
MIRT974898	hsa-miR-665	CLIP-seq
MIRT974899	hsa-miR-762	CLIP-seq
MIRT974900	hsa-miR-940	CLIP-seq
MIRT974861	hsa-miR-1273e	CLIP-seq
MIRT974863	hsa-miR-1304	CLIP-seq
MIRT1988838	hsa-miR-146a	CLIP-seq
MIRT1988839	hsa-miR-146b-5p	CLIP-seq
MIRT974865	hsa-miR-1827	CLIP-seq
MIRT1988840	hsa-miR-31	CLIP-seq
MIRT1988841	hsa-miR-380	CLIP-seq
MIRT974877	hsa-miR-4433	CLIP-seq
MIRT974878	hsa-miR-4459	CLIP-seq
MIRT1988842	hsa-miR-4495	CLIP-seq
MIRT1988843	hsa-miR-4511	CLIP-seq
MIRT1988844	hsa-miR-4695-3p	CLIP-seq
MIRT974885	hsa-miR-4722-5p	CLIP-seq
MIRT1988845	hsa-miR-548b-3p	CLIP-seq
MIRT974894	hsa-miR-582-5p	CLIP-seq
MIRT1988846	hsa-miR-589	CLIP-seq
MIRT974895	hsa-miR-610	CLIP-seq
MIRT974898	hsa-miR-665	CLIP-seq
MIRT974900	hsa-miR-940	CLIP-seq
MIRT974862	hsa-miR-1285	CLIP-seq
MIRT974863	hsa-miR-1304	CLIP-seq
MIRT974868	hsa-miR-3187-5p	CLIP-seq
MIRT974877	hsa-miR-4433	CLIP-seq
MIRT1988844	hsa-miR-4695-3p	CLIP-seq
MIRT974894	hsa-miR-582-5p	CLIP-seq
MIRT974895	hsa-miR-610	CLIP-seq
MIRT974896	hsa-miR-612	CLIP-seq
MIRT974897	hsa-miR-661	CLIP-seq
MIRT974898	hsa-miR-665	CLIP-seq
MIRT974863	hsa-miR-1304	CLIP-seq
MIRT974865	hsa-miR-1827	CLIP-seq
MIRT974878	hsa-miR-4459	CLIP-seq
MIRT974885	hsa-miR-4722-5p	CLIP-seq
MIRT974890	hsa-miR-499-3p	CLIP-seq
MIRT974891	hsa-miR-499a-3p	CLIP-seq
MIRT974894	hsa-miR-582-5p	CLIP-seq
MIRT974895	hsa-miR-610	CLIP-seq
MIRT974900	hsa-miR-940	CLIP-seq
MIRT974862	hsa-miR-1285	CLIP-seq
MIRT974868	hsa-miR-3187-5p	CLIP-seq
MIRT974896	hsa-miR-612	CLIP-seq
MIRT974897	hsa-miR-661	CLIP-seq
MIRT974862	hsa-miR-1285	CLIP-seq
MIRT974868	hsa-miR-3187-5p	CLIP-seq
MIRT974896	hsa-miR-612	CLIP-seq
MIRT974897	hsa-miR-661	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
GATA4	Activation	17290010;22539995
HNF4A	Activation	17343826
PIAS1	Activation	22539995

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005324	Function	Long-chain fatty acid transmembrane transporter activity	IEA
GO:0005504	Function	Fatty acid binding	IEA
GO:0005504	Function	Fatty acid binding	TAS	2824476
GO:0005515	Function	Protein binding	IPI	21044950, 25416956, 25910212
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005902	Component	Microvillus	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0015908	Process	Fatty acid transport	IBA
GO:0015908	Process	Fatty acid transport	IEA
GO:0015909	Process	Long-chain fatty acid transport	IEA
GO:0036041	Function	Long-chain fatty acid binding	IBA
GO:0036041	Function	Long-chain fatty acid binding	IDA	7883976
GO:0036041	Function	Long-chain fatty acid binding	IEA
GO:0045179	Component	Apical cortex	IEA
GO:0050892	Process	Intestinal absorption	IEA
GO:0098856	Process	Intestinal lipid absorption	IMP	7883976

MIM	HGNC	e!Ensembl
134640	3556	ENSG00000145384

P12104

Protein name

Fatty acid-binding protein, intestinal (Fatty acid-binding protein 2) (Intestinal-type fatty acid-binding protein) (I-FABP)

Protein function

FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affini

PDB

1KZW , 1KZX , 2MJI , 2MO5 , 3AKM , 3IFB , 6L7K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	4 → 132	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum. {ECO:0000269|PubMed:14563446}.

Sequence

MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD

Sequence length

132

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Fat digestion and absorption		Triglyceride catabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CAROTID STENOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FABP2 POLYMORPHISM	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (84)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	29771764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30947347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27778448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11487582, 11707533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11707533, 27778448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10946885, 15527447, 17907115, 24340071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17907115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	17907115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	16013194, 17212611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	17212611		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	26346822	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	28819290, 31907928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18506375, 25262933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	LHGDN	18506375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10946885, 25262933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	15527447, 16013194, 17212611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	26019038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19288030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20308031, 23826253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23826253, 39242607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	39563343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11730822, 12189904, 15135251, 9589253		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	11730822, 12189904, 15059615, 15135251, 9589253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	39563343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	39563343	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11730822, 12189904, 15135251, 9589253		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Coronary stenosis	Pubtator	39563343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10480621, 15598690, 16013194, 16945373, 17292994, 20202768, 20484485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	11832353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10480621, 15598690, 16013194, 16945373, 17292994, 18506375, 20202768, 20484485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15159243, 22174922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34362459	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	39563343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21288588, 23468166, 24690233, 26703680, 28738793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31610731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10229304, 10480621, 10999802, 11423496, 11593593, 11699048, 12161503, 12209017, 12646233, 12855223, 15059615, 16249461, 16718625, 16718632, 17292994 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29404926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	11866034, 12161503, 15527447, 15547295, 15598690, 16013194, 16945373, 20047744, 26703680, 9194752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	15547295, 20534879, 22838187, 26703680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	15598690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	32973805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	34418984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	25357227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	25357227, 25587205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29304196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gerstmann-Straussler-Scheinker Disease	Gerstmann-Straussler-Scheinker syndrome	BEFREE	26019038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17209184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17143557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10480621, 11288045, 18701184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	11108733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	11699048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	12370850, 9194752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	11487582, 17209184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17594477, 25357227, 25587205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10443326, 18506375, 25357227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	15159243, 15547295, 16908951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	15059615, 15135268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	LHGDN	18201778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11108733, 11299043, 11707533, 14981227, 15159243, 15547295, 16908951, 17907115, 17921407, 19439328, 20534879, 23826253, 30927395, 7883976, 8631905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	33602945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	16249461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	24340071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	33057211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	18282109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29338565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20534879, 22838187, 28738793, 30927395	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	10443326, 11423496, 12189904, 15547295, 15598690, 15869758, 16013194, 16718632, 16919542, 20723947, 22838187, 23911300, 25730055, 28738793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	23818854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19361803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	12479590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	19961041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10337870, 11593593, 11707533, 11866034, 12855223, 14686962, 14981227, 15620432, 16718632, 17211557, 17992640, 19324445, 19475463, 20202768, 21079390, 25730055, 26238699, 28738793, 9253345 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	11707533, 14981227, 16908951, 17907115, 28738793, 28760427, 30021629, 30927395, 34206471, 35627568	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	30927395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	11866034, 28760427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent depression	Mental Depression	BEFREE	24340071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	16679929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	36642764	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	25262933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	15527447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	15527447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18201778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	18206169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Winter Shortland Temple syndrome	Winter shortland temple syndrome	Pubtator	25701868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FABP2 (fatty acid binding protein 2)