Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2166
Gene name	Fatty acid amide hydrolase
Gene symbol	FAAH
Synonyms (NCBI Gene)	FAAH-1FAAH1PSAB
Chromosome	1
Chromosome location	1p33
Summary	This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide. [provided by RefSeq, Jul 2008]

126

Show/Hide all (126)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038079	hsa-miR-423-5p	CLASH	23622248
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT510260	hsa-miR-4459	PAR-CLIP	20371350
MIRT510259	hsa-miR-665	PAR-CLIP	20371350
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	20371350
MIRT510257	hsa-miR-4537	PAR-CLIP	20371350
MIRT510256	hsa-miR-6087	PAR-CLIP	20371350
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT510254	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT510253	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT510260	hsa-miR-4459	PAR-CLIP	20371350
MIRT510259	hsa-miR-665	PAR-CLIP	20371350
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	20371350
MIRT510257	hsa-miR-4537	PAR-CLIP	20371350
MIRT510256	hsa-miR-6087	PAR-CLIP	20371350
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT510254	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT510253	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT510260	hsa-miR-4459	PAR-CLIP	23446348
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT510257	hsa-miR-4537	PAR-CLIP	23446348
MIRT510256	hsa-miR-6087	PAR-CLIP	23446348
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT510254	hsa-miR-25-5p	PAR-CLIP	23446348
MIRT510253	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT519268	hsa-miR-1273e	PAR-CLIP	23446348
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT510260	hsa-miR-4459	PAR-CLIP	23446348
MIRT510259	hsa-miR-665	PAR-CLIP	23446348
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT510257	hsa-miR-4537	PAR-CLIP	23446348
MIRT510256	hsa-miR-6087	PAR-CLIP	23446348
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT510254	hsa-miR-25-5p	PAR-CLIP	23446348
MIRT510253	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT462042	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462043	hsa-miR-1321	PAR-CLIP	23592263
MIRT462041	hsa-miR-4739	PAR-CLIP	23592263
MIRT462040	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT462039	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT462038	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT462037	hsa-miR-4419a	PAR-CLIP	23592263
MIRT462036	hsa-miR-4510	PAR-CLIP	23592263
MIRT462035	hsa-miR-6127	PAR-CLIP	23592263
MIRT462033	hsa-miR-6129	PAR-CLIP	23592263
MIRT462034	hsa-miR-6130	PAR-CLIP	23592263
MIRT462032	hsa-miR-6133	PAR-CLIP	23592263
MIRT462031	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT462030	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT510260	hsa-miR-4459	PAR-CLIP	20371350
MIRT510259	hsa-miR-665	PAR-CLIP	20371350
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	20371350
MIRT510257	hsa-miR-4537	PAR-CLIP	20371350
MIRT510256	hsa-miR-6087	PAR-CLIP	20371350
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT510254	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT510253	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT510260	hsa-miR-4459	PAR-CLIP	20371350
MIRT510259	hsa-miR-665	PAR-CLIP	20371350
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	20371350
MIRT510257	hsa-miR-4537	PAR-CLIP	20371350
MIRT510256	hsa-miR-6087	PAR-CLIP	20371350
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT510254	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT510253	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT510260	hsa-miR-4459	PAR-CLIP	23446348
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT510257	hsa-miR-4537	PAR-CLIP	23446348
MIRT510256	hsa-miR-6087	PAR-CLIP	23446348
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT510254	hsa-miR-25-5p	PAR-CLIP	23446348
MIRT510253	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT519268	hsa-miR-1273e	PAR-CLIP	23446348
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT510261	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT510260	hsa-miR-4459	PAR-CLIP	23446348
MIRT510259	hsa-miR-665	PAR-CLIP	23446348
MIRT510258	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT510257	hsa-miR-4537	PAR-CLIP	23446348
MIRT510256	hsa-miR-6087	PAR-CLIP	23446348
MIRT510255	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT510254	hsa-miR-25-5p	PAR-CLIP	23446348
MIRT510253	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT510252	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT462042	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT462043	hsa-miR-1321	PAR-CLIP	23592263
MIRT462041	hsa-miR-4739	PAR-CLIP	23592263
MIRT462040	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT462039	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT462038	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT462037	hsa-miR-4419a	PAR-CLIP	23592263
MIRT462036	hsa-miR-4510	PAR-CLIP	23592263
MIRT462035	hsa-miR-6127	PAR-CLIP	23592263
MIRT462033	hsa-miR-6129	PAR-CLIP	23592263
MIRT462034	hsa-miR-6130	PAR-CLIP	23592263
MIRT462032	hsa-miR-6133	PAR-CLIP	23592263
MIRT462031	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT462030	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT974851	hsa-miR-1266	CLIP-seq
MIRT974852	hsa-miR-198	CLIP-seq
MIRT974853	hsa-miR-3689d	CLIP-seq
MIRT974854	hsa-miR-4270	CLIP-seq
MIRT974855	hsa-miR-4441	CLIP-seq
MIRT974856	hsa-miR-4518	CLIP-seq
MIRT974857	hsa-miR-4534	CLIP-seq
MIRT974858	hsa-miR-4802-5p	CLIP-seq
MIRT974859	hsa-miR-510	CLIP-seq
MIRT974851	hsa-miR-1266	CLIP-seq
MIRT974852	hsa-miR-198	CLIP-seq
MIRT974853	hsa-miR-3689d	CLIP-seq
MIRT974854	hsa-miR-4270	CLIP-seq
MIRT974855	hsa-miR-4441	CLIP-seq
MIRT974856	hsa-miR-4518	CLIP-seq
MIRT2223234	hsa-miR-4785	CLIP-seq
MIRT974859	hsa-miR-510	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
STAT3	Activation	12556536

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004040	Function	Amidase activity	IBA
GO:0004040	Function	Amidase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005543	Function	Phospholipid binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0009062	Process	Fatty acid catabolic process	IBA
GO:0009062	Process	Fatty acid catabolic process	IDA	9122178
GO:0009062	Process	Fatty acid catabolic process	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IEA
GO:0017064	Function	Fatty acid amide hydrolase activity	EXP	17015445
GO:0017064	Function	Fatty acid amide hydrolase activity	IBA
GO:0017064	Function	Fatty acid amide hydrolase activity	IDA	9122178
GO:0017064	Function	Fatty acid amide hydrolase activity	IEA
GO:0017064	Function	Fatty acid amide hydrolase activity	ISS
GO:0019369	Process	Arachidonate metabolic process	TAS
GO:0031090	Component	Organelle membrane	IEA
GO:0031090	Component	Organelle membrane	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0047372	Function	Monoacylglycerol lipase activity	IEA
GO:0047372	Function	Monoacylglycerol lipase activity	ISS
GO:0052651	Process	Monoacylglycerol catabolic process	IEA
GO:0052651	Process	Monoacylglycerol catabolic process	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150036	Process	Regulation of trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IEA

MIM	HGNC	e!Ensembl
602935	3553	ENSG00000117480

O00519

Protein name

Fatty-acid amide hydrolase 1 (EC 3.5.1.99) (Anandamide amidohydrolase 1) (Fatty acid ester hydrolase) (EC 3.1.1.-) (Oleamide hydrolase 1)

Protein function

Catalyzes the hydrolysis of endogenous amidated lipids like the sleep-inducing lipid oleamide ((9Z)-octadecenamide), the endocannabinoid anandamide (N-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-ethanolamine), as well as other fatty amides, to their corres

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01425	Amidase	95 → 562	Amidase	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the brain, small intestine, pancreas, skeletal muscle and testis. Also expressed in the kidney, liver, lung, placenta and prostate. {ECO:0000269|PubMed:17015445}.

Sequence

MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS

Sequence length

579

Interactions

View interactions

	KEGG		Reactome
	Retrograde endocannabinoid signaling		Arachidonic acid metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Polysubstance abuse, susceptibility to	Likely pathogenic	rs2522820995	RCV003990696	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAAH POLYMORPHISM	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAAH-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

FAAH (fatty acid amide hydrolase)