ALDH1A1 (aldehyde dehydrogenase 1 family member A1)

Gene

• Entrez ID: 216
• Gene name: Aldehyde dehydrogenase 1 family member A1
• Gene symbol: ALDH1A1
• Synonyms (NCBI Gene): ALDC, ALDH-E1, ALDH1, ALDH11, HEL-9, HEL-S-53e, HEL12, PUMB1, RALDH1
• Chromosome: 9
• Chromosome location: 9q21.13
• Summary: The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liv

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053112	hsa-miR-140-5p	Luciferase reporter assay, Western blot	23752191
MIRT053112	hsa-miR-140-5p	Luciferase reporter assay, Western blot	23752191
MIRT776938	hsa-miR-1184	CLIP-seq
MIRT776939	hsa-miR-1205	CLIP-seq
MIRT776940	hsa-miR-1283	CLIP-seq
MIRT776941	hsa-miR-3158-5p	CLIP-seq
MIRT776942	hsa-miR-3664-5p	CLIP-seq
MIRT776943	hsa-miR-4699-3p	CLIP-seq
MIRT776944	hsa-miR-4714-5p	CLIP-seq
MIRT776945	hsa-miR-520d-5p	CLIP-seq
MIRT776946	hsa-miR-524-5p	CLIP-seq
MIRT1555915	hsa-miR-562	CLIP-seq
MIRT2170094	hsa-miR-4328	CLIP-seq
MIRT2426186	hsa-miR-1275	CLIP-seq
MIRT2426187	hsa-miR-1305	CLIP-seq
MIRT2426188	hsa-miR-132	CLIP-seq
MIRT2426189	hsa-miR-1323	CLIP-seq
MIRT2426190	hsa-miR-200b	CLIP-seq
MIRT2426191	hsa-miR-200c	CLIP-seq
MIRT2426192	hsa-miR-21	CLIP-seq
MIRT2426193	hsa-miR-212	CLIP-seq
MIRT2426194	hsa-miR-221	CLIP-seq
MIRT2426195	hsa-miR-222	CLIP-seq
MIRT2426196	hsa-miR-23a	CLIP-seq
MIRT2426197	hsa-miR-23b	CLIP-seq
MIRT2426198	hsa-miR-23c	CLIP-seq
MIRT2426199	hsa-miR-297	CLIP-seq
MIRT2426200	hsa-miR-3115	CLIP-seq
MIRT2426201	hsa-miR-3117-3p	CLIP-seq
MIRT2426202	hsa-miR-3132	CLIP-seq
MIRT2426203	hsa-miR-3153	CLIP-seq
MIRT2426204	hsa-miR-3163	CLIP-seq
MIRT2426205	hsa-miR-3169	CLIP-seq
MIRT2426206	hsa-miR-3173-3p	CLIP-seq
MIRT2426207	hsa-miR-3185	CLIP-seq
MIRT2426208	hsa-miR-335	CLIP-seq
MIRT2426209	hsa-miR-374c	CLIP-seq
MIRT2426210	hsa-miR-3913-3p	CLIP-seq
MIRT2426211	hsa-miR-3942-3p	CLIP-seq
MIRT2426212	hsa-miR-4282	CLIP-seq
MIRT2426213	hsa-miR-429	CLIP-seq
MIRT2426214	hsa-miR-4307	CLIP-seq
MIRT2426215	hsa-miR-4326	CLIP-seq
MIRT2170094	hsa-miR-4328	CLIP-seq
MIRT2426216	hsa-miR-4428	CLIP-seq
MIRT2426217	hsa-miR-4475	CLIP-seq
MIRT2426218	hsa-miR-4477a	CLIP-seq
MIRT2426219	hsa-miR-4496	CLIP-seq
MIRT2426220	hsa-miR-4517	CLIP-seq
MIRT2426221	hsa-miR-455-3p	CLIP-seq
MIRT2426222	hsa-miR-4665-5p	CLIP-seq
MIRT2426223	hsa-miR-4666-5p	CLIP-seq
MIRT2426224	hsa-miR-4668-3p	CLIP-seq
MIRT2426225	hsa-miR-4708-5p	CLIP-seq
MIRT2426226	hsa-miR-4709-3p	CLIP-seq
MIRT2426227	hsa-miR-4759	CLIP-seq
MIRT2426228	hsa-miR-4795-3p	CLIP-seq
MIRT2426229	hsa-miR-485-3p	CLIP-seq
MIRT2426230	hsa-miR-487a	CLIP-seq
MIRT2426231	hsa-miR-489	CLIP-seq
MIRT2426232	hsa-miR-5095	CLIP-seq
MIRT2426233	hsa-miR-511	CLIP-seq
MIRT2426234	hsa-miR-514	CLIP-seq
MIRT2426235	hsa-miR-514b-3p	CLIP-seq
MIRT2426236	hsa-miR-548c-3p	CLIP-seq
MIRT2426237	hsa-miR-548o	CLIP-seq
MIRT2426238	hsa-miR-567	CLIP-seq
MIRT2426239	hsa-miR-590-5p	CLIP-seq
MIRT2426240	hsa-miR-607	CLIP-seq
MIRT2426241	hsa-miR-651	CLIP-seq
MIRT2426242	hsa-miR-655	CLIP-seq
MIRT2426243	hsa-miR-891b	CLIP-seq
MIRT2426244	hsa-miR-944	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EZH2	Repression	22144423
TLX1	Unknown	18073142;18082256

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001523	Process	Retinoid metabolic process	ISS
GO:0001758	Function	Retinal dehydrogenase (NAD+) activity	IEA
GO:0001758	Function	Retinal dehydrogenase (NAD+) activity	ISS
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	IDA	4015840, 12941160, 23444097, 25450233
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	IEA
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	IMP	15623782
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	TAS	1709013
GO:0005096	Function	GTPase activator activity	TAS	1709013
GO:0005497	Function	Androgen binding	TAS	1709013
GO:0005515	Function	Protein binding	IPI	32814053, 33495566
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	2987944
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	12941160
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006081	Process	Aldehyde metabolic process	IBA
GO:0006081	Process	Aldehyde metabolic process	TAS	1709013
GO:0006629	Process	Lipid metabolic process	IEA
GO:0009449	Process	Gamma-aminobutyric acid biosynthetic process	ISS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016620	Function	Oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	IEA
GO:0018479	Function	Benzaldehyde dehydrogenase (NAD+) activity	IBA
GO:0018479	Function	Benzaldehyde dehydrogenase (NAD+) activity	IEA
GO:0019145	Function	Aminobutyraldehyde dehydrogenase (NAD+) activity	IEA
GO:0019145	Function	Aminobutyraldehyde dehydrogenase (NAD+) activity	ISS
GO:0030392	Process	Fructosamine catabolic process	IDA	17175089
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0036438	Process	Maintenance of lens transparency	ISS
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	ISS
GO:0051287	Function	NAD binding	ISS	12693930
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0106373	Function	3-deoxyglucosone dehydrogenase activity	IDA	17175089
GO:0106373	Function	3-deoxyglucosone dehydrogenase activity	IEA
GO:0110095	Process	Cellular detoxification of aldehyde	IMP	15623782
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	22561685
GO:0140087	Function	Acetaldehyde dehydrogenase (NAD+) activity	IEA

Other IDs

• MIM: 100640
• HGNC: 402
• e!Ensembl: ENSG00000165092

Protein

• UniProt ID: P00352
• Protein name: Aldehyde dehydrogenase 1A1 (EC 1.2.1.19) (EC 1.2.1.28) (EC 1.2.1.3) (EC 1.2.1.36) (3-deoxyglucosone dehydrogenase) (ALDH-E1) (ALHDII) (Aldehyde dehydrogenase family 1 member A1) (Aldehyde dehydrogenase, cytosolic) (Retinal dehydrogenase 1) (RALDH 1) (RalD
• Protein function: Cytosolic dehydrogenase that catalyzes the irreversible oxidation of a wide range of aldehydes to their corresponding carboxylic acid (PubMed:12941160, PubMed:15623782, PubMed:17175089, PubMed:19296407, PubMed:25450233, PubMed:26373694). Functio
• PDB: 4WB9, 4WJ9, 4WP7, 4WPN, 4X4L, 5AC2, 5L2M, 5L2N, 5L2O, 5TEI, 6DUM, 7JWS, 7JWT, 7JWU, 7JWV, 7JWW, 7UM9, 8D46, 8DNO, 8ENE, 8PVH, 8T0N, 8T0T, 8WFQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00171	Aldedh	29 → 492	Aldehyde dehydrogenase family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed by erythrocytes (at protein level). {ECO:0000269|PubMed:17175089}.
• Sequence:

  MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDV
  DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
  NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
  GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
  KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
  QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
  GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
  ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGE
  YGFHEYTEVKTVTVKISQKNS

• Sequence length: 501

Pathways

KEGG:

Retinol metabolism
Metabolic pathways

Reactome:

RA biosynthesis pathway
Fructose catabolism
Ethanol oxidation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CREUTZFELDT-JAKOB DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CREUTZFELDT-JAKOB SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	21804471, 22012766, 22142828, 23060121, 23762304, 25971681, 26366059, 28467793, 29181106, 30923946		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27813328, 28476825, 30923946, 31695757		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	23762304, 25971681		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	19329942, 21231983, 25045085		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28467793, 28484082		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	28484082		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	22012766		★☆☆☆☆ Found in Text Mining only
Adrenal Cortex Diseases	Adrenal Cortex Diseases	BEFREE	30121075		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	25344211		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26896768		★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	28766250		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29948941, 36776048	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	35349099	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	24727741		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	BEFREE	30292490		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	Pubtator	34827649	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26279302, 30172883, 30250298, 31465125		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	24567230		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	24567230	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	24567230		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	38243323	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27136105	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28783931		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal Dominant Juvenile Parkinson Disease	Parkinson Disease	CTD_human_DG	25045800		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	CTD_human_DG	25045800		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Parkinsonism	Parkinsonian disease	CTD_human_DG	25045800		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27813328		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	24285572		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal cell nevus syndrome	Pubtator	24285572	Associate	★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	BEFREE	28052035		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	23969936, 26894647		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31187490		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	35078784	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	20627895	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19149630, 19329942, 20010944, 20596639, 21187973, 22037257, 22111833, 22930220, 22938492, 23012411, 23661606, 23982874, 23999597, 24043631, 24142344, 24889938, 24938375, 25106087, 25182808, 25209720, 25384215, 25582316, 26167915, 26230297, 26232424, 26398662, 26460550, 26462023, 27229859, 28422735, 28454215, 28570747, 28640095, 28756208, 28937653, 29062075, 29133591, 29190005, 29228728, 29353288, 29393296, 29416796, 29486751, 29622580, 29685462, 29693231, 29843115, 29845398, 29924962, 29938344, 30142860, 30184527, 30362671, 30364293, 30405844, 30541574, 30559934, 31208996, 31352658, 31424661		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19329942, 19385968, 19899128, 20010944, 20043317, 20103682, 20228222, 20603432, 21187973, 21336637, 21399615, 21559013, 21907803, 22037257, 22080062, 22280212, 22407396, 22877687, 22938492, 23049880, 23759596, 23787917, 23813303, 23982874, 23999597, 24043631, 24338721, 24762066, 25120797, 25182808, 25582316, 25743329, 26070788, 26091795, 26115764, 26167915, 26305673, 26460550, 26462023, 27115469, 27368476, 27768764, 28112378, 28302531, 28640095, 29353288, 29393296, 29747452, 29924962, 30091683, 30184527, 30307804, 30362671, 30909144, 32316333, 32695508, 33390842, 33746592, 34073849, 35280989, 37147285, 38031089, 40076923	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	26458734		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	26458734		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22012766, 22100631, 24285572, 38126564	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23236537	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	39986058	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23060121, 28418868, 31444928, 31451895		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	22581680	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	30362671	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	26625750	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	19329942, 21231983, 25045085, 30907484	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26160842, 28792511, 31177062, 38287800, 7615557	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	23752191, 23759596	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	23236537	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	19583841	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	23813303	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31187490		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21118965, 22617249, 24309934, 25955300, 26230297, 27813328, 28122729, 28415606, 28722353, 28978015		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22144423, 23762304, 36768723	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22852552	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24116047, 24266898, 35412614	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21804471, 24346092, 26499463, 36504325, 37378913	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38126564	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	26391478		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	19329942, 21231983, 25045085, 30907484		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19329942, 22144423, 23762304, 24954508, 26148881, 27443528, 27803105, 28525846, 29662319, 29753392, 30166520, 30965686, 31534014, 31595974		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	31479653		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21804471, 30150594		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21804471, 25864109, 30150594, 30344706		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26896768		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31665232		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	32039729	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	31651977		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29328371, 29902974, 30166520, 30922918		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36162455	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20606680, 23980595, 24402192, 25585687, 26230297, 26358078, 27152521, 27234655, 28431527, 28464221, 28484082, 29343849, 29748529, 30174443, 30308036, 30833990, 31017126		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20135722, 20606680, 22405917, 23768832, 24786601, 26358078, 28394276, 28431527, 28881356, 29748529, 30272331, 30308036, 32225170, 34288405, 38287800	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24599561	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30308036		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23585015, 24116047		★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Familial	Creutzfeldt-Jakob disease	CTD_human_DG	23349890		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24503130		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	17222227		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	21410762		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30905621		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30905621		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31315286, 31446444	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36401196	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	32951453	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25344211		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	26091795		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	30837649		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	21410762		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30372483		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	34099751	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30372483, 31122521, 34099751, 36720532	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	31122521		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	31122521		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22144423, 23762304, 31534014		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24210755, 28888039, 29085496, 30172883		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24210755, 28888039, 30172883		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24210755	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25148045	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28148901		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	23805041		★☆☆☆☆ Found in Text Mining only
Familial Juvenile Parkinsonism	Parkinsonian disease	CTD_human_DG	25045800		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	25340704		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	25340704		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	38034016	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29718361, 30379862		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	17553814, 18343808		★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	24289252		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	20596639		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	26318430		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	26318430	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	21617755		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	21617755, 22312193	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20627895, 22417385, 23132408	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24197864, 31270152		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23132408, 24197864, 31270152		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22417385, 25192910	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25192910		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30885956		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	27928651		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21292542, 24475244, 31444928		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24475244, 24527751, 32701933	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	29189260		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	32094357	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	23999597, 26318430	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Types I and II	Hereditary angioedema	Pubtator	25971681	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19806016, 21399615, 22930220	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20530687		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	23759596		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	29779037		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31665232		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30362671		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	35848480, 36033826	Associate	★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	30683135		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20596639, 25582316, 26366059, 28280079, 30220009		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25582316, 26366059, 27015121, 30220009	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37359050, 37761947	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27611922, 27826122, 28280079		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	22782852, 28123562, 29189260		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	30683135		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	22100631, 22725270, 22782852, 28123562, 28939082		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	29718361	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24276407, 26160842, 26896768, 28792511, 30959553, 31054270, 7779080		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	18644979		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	7779080		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23236537, 24671051	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17111384, 24685647, 27813328, 32971893, 35078784, 36504325	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28722353		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	26167915		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21231983, 22012766, 22341992, 22407396, 23768832, 25253129, 26305673, 26358078, 26625750, 27368476, 27832750, 28431527, 28640095, 32951453, 34655409, 35194895	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24376714	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29748529	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	30417470		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	29399699		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	29399699		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	29399699		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21292542, 24475244, 31444928		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19149630, 19329942, 19385968, 20010944, 20596639, 21187973, 22037257, 22111833, 22930220, 22938492, 23012411, 23053657, 23661606, 23982874, 23999597, 24043631, 24142344, 24889938, 24938375, 25106087, 25182808, 25209720, 25384215, 25582316, 26167915, 26230297, 26232424, 26398662, 26460550, 26462023, 27229859, 28422735, 28454215, 28570747, 28640095, 28756208, 28937653, 29062075, 29133591, 29190005, 29228728, 29353288, 29393296, 29416796, 29486751, 29500278, 29622580, 29685462, 29693231, 29843115, 29845398, 29924962, 29938344, 30142860, 30184527, 30362671, 30364293, 30405844, 30541574, 30559934, 31208996, 31352658, 31424661		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30372483		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24210755, 28888039, 30172883		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	26318430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26896768		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21118965, 22617249, 24309934, 25955300, 26230297, 27813328, 28122729, 28415606, 28722353, 28978015		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	22100631, 22725270, 22782852, 28123562, 28939082		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19329942, 23762304, 24954508, 26148881, 27443528, 27803105, 28525846, 29662319, 29753392, 30166520, 30965686, 31595974		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21708005, 22710732, 24676703, 25451256, 25769430, 28193222		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22608744, 23969936, 24762960, 26894647, 26990292, 30287243		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	26391478		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25253129, 27176706, 28046028, 31611965		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24727741		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31187490		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19450560, 20036608, 20596639, 20889728, 21280157, 21708005, 21804471, 22037257, 22100631, 22237177, 22608744, 22710732, 22725270, 22782852, 22847005, 22930220, 22938492, 23585015, 23760992, 23922106, 24276407, 24337682, 24376795, 24577091, 24676703, 24883329, 24938375, 24954508, 25181420, 25253129, 25279549, 25449776, 25451256, 25742746, 25760144, 25788273, 25864109, 25881507, 26148881, 26160842, 26230297, 26323893, 26391478, 26399460, 26894647, 27002147, 27130942, 27331345, 27368476, 27542268, 27813328, 27909720, 27913042, 27926487, 28106104, 28148901, 28184944, 28193222, 28423035, 28423611, 28431527, 28438662, 28454215, 28467793, 28475748, 28476825, 28604744, 28640095, 28722353, 28792511, 28806395, 28811252, 28851663, 28939082, 28952294, 29062075, 29069808, 29085496, 29306324, 29432994, 29500278, 29511206, 29662319, 29693231, 29744876, 29753392, 29767973, 29791975, 29845398, 29924962, 30002278, 30013043, 30118845, 30142860, 30144515, 30166520, 30250298, 30293938, 30305380, 30308036, 30441806, 30504718, 30683135, 30717428, 30818757, 30867410, 30958995, 30999901, 31054270, 31368107, 31611965, 31693936, 31738518, 31770189, 31811857		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21804471, 30150594		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29328371, 29902974, 30166520		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19899128, 21187973, 29100291, 30541574		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25643237, 26242870, 26391478, 28106104, 30293938, 30377573, 31580832		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	26391478, 28106104, 29229936, 31580832, 37796710	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	31580832		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	24252471		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	17286337		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28811252		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	31580832		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22100631	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	29555661		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24594504, 29665144, 30912465		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	32157826	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27826122		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27647953, 27891591		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27647953	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17974998, 18082256, 19329942, 19385968, 19450560, 20036608, 20889728, 21850700, 21957977, 22012766, 22037257, 22111833, 22710732, 22938492, 22941572, 23543150, 23548270, 23585015, 23621188, 23752191, 23759596, 23813303, 24197864, 24252471, 24708484, 24938375, 25253129, 25340704, 25384215, 25576341, 25585687, 25643237, 25742746, 25788273, 25881507, 25971681, 26115764, 26148881, 26160842, 26242870, 26323893, 26358078, 26399460, 26407842, 26456957, 26462023, 26894647, 27020553, 27292183, 27402613, 27647953, 27724856, 27803105, 27891591, 28358430, 28440478, 28454215, 28475748, 28498445, 28581514, 28640095, 28797171, 28888039, 28939082, 28978015, 29085496, 29088802, 29100291, 29112953, 29416613, 29555661, 29603383, 29662319, 29685462, 29748529, 29753392, 29779037, 29791975, 29845398, 29921496, 29924962, 30144515, 30166520, 30241364, 30287243, 30308036, 30705400, 30833990, 31181618, 31341493, 31352658, 31424661, 31451895, 31611965, 31617074, 31665232, 8562935		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	25068119, 31202518		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	34941945	Associate	★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	31131824		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27724856		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	31131824		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	31131824		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	39208548	Associate	★☆☆☆☆ Found in Text Mining only
New Variant Creutzfeldt-Jakob Disease	Creutzfeldt-Jakob Disease	CTD_human_DG	23349890		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	29718361		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19025616, 21118965, 22115706, 22617249, 24422956, 25831148, 25881507, 25955300, 26366059, 27542268, 28420235, 28440478, 28693170, 28949784, 29069808, 30305380, 30448845, 30923946, 31289574, 31534455		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	29718361		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	23752191, 23759596		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17529981, 28919001, 31816557		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	31760402		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31596733		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25576341, 30793158, 30984551, 31000382		★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	25971681		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	19329942, 26148881		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29603383		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	24998918, 29752431	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19329942, 23762304, 24954508, 27443528, 27803105, 28525846, 29662319, 29753392, 30166520, 30965686, 31595974		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19329942, 22852552, 23762304, 24998918, 25216266, 25971681, 25999351, 26148881, 28525846, 29752431, 30583585, 35090523, 35328460, 36768723, 37628927	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25216223	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	28851663		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21708005, 22710732, 24676703, 25451256, 25769430, 28193222		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18848913		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21708005, 22710732, 25240521, 25451256, 26458814, 28193222, 40055736	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28687160, 29574154		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	29891189		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	14678778, 21069393, 22380773, 23046827, 23786406, 24865427, 25045800, 25298080, 28706191, 30837649, 31649613		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	22380773	Inhibit	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35578164	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CTD_human_DG	25045800		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	CTD_human_DG	25045800		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonism, Juvenile	Parkinsonian disease	CTD_human_DG	25045800		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	29229936	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	28783931		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	18807137		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22608744, 23969936, 24762960, 26894647, 26990292, 30287243		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22901151, 28510291, 33068330, 36778142	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	25670168, 28938627		★☆☆☆☆ Found in Text Mining only
Ramsay Hunt Paralysis Syndrome	Ramsay Hunt Paralysis Syndrome	CTD_human_DG	25045800		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	24327017, 26456957		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	25106087, 29948941		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24116047		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25106087, 29948941		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	35848479	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	20596639, 22928012, 24252471		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	22928012	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	28766250	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	28148901	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	24376795		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	14678778, 19703508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	14678778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	19176379		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28212573, 28448532	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	22111833		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21804471, 26366059, 26391478, 28699108, 29791975, 29963189		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21672255, 28431580, 28475748, 28888039, 28964573		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21304586, 22341992, 22847005, 24527751, 24883329, 27002147, 28381191, 30430416, 32588101, 32669963, 32701933, 32951453, 34655409, 35225452, 35848480, 36261806, 38096163	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	29779037		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29432994		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17974998, 19450560, 21294122, 21850700, 22361100, 22847005, 25340704, 26323893, 26399460, 27002147, 28865486, 29112953, 30241364, 31811857		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30379862		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25253129, 27176706, 28046028, 31611965		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25253129, 27015121, 31127138, 35996148, 37277751	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33788653	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	25218607	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	24252471		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	19886994	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24485040	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24727741		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	24727741	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24727741		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	39595993	Associate	★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	28052035		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22626806, 22930220, 26462023, 28383433, 29693231, 30679159		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24338721, 25743329, 26462023, 27994520, 28383433, 32665537, 35135840, 37147285, 38188613, 40076923	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24716927, 34101386, 35008872, 40016843	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	22899292	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35295009	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21804471, 25755785, 25864109, 28449663, 30150594, 35194895	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30791957, 35295009	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	17553814, 18343808, 29568968		★☆☆☆☆ Found in Text Mining only