Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2149
Gene name	Coagulation factor II thrombin receptor
Gene symbol	F2R
Synonyms (NCBI Gene)	CF2RHTRPAR-1PAR1TR
Chromosome	5
Chromosome location	5q13.3
Summary	Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results i

355

Show/Hide all (355)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052570	hsa-let-7a-5p	CLASH	23622248
MIRT037083	hsa-miR-877-3p	CLASH	23622248
MIRT706041	hsa-miR-186-3p	HITS-CLIP	22927820
MIRT706040	hsa-miR-150-5p	HITS-CLIP	22927820
MIRT706039	hsa-miR-3653-5p	HITS-CLIP	22927820
MIRT706038	hsa-miR-1976	HITS-CLIP	22927820
MIRT706037	hsa-miR-6790-3p	HITS-CLIP	22927820
MIRT706036	hsa-miR-6821-3p	HITS-CLIP	22927820
MIRT706035	hsa-miR-6778-3p	HITS-CLIP	22927820
MIRT706034	hsa-miR-1193	HITS-CLIP	22927820
MIRT706033	hsa-miR-378a-5p	HITS-CLIP	22927820
MIRT706032	hsa-miR-640	HITS-CLIP	22927820
MIRT706031	hsa-miR-6843-3p	HITS-CLIP	22927820
MIRT706030	hsa-miR-6848-3p	HITS-CLIP	22927820
MIRT571222	hsa-miR-3609	PAR-CLIP	20371350
MIRT571221	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT216663	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT216664	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT216660	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT216661	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT216667	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT216671	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT216670	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT216662	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT571220	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT216674	hsa-miR-33b-3p	PAR-CLIP	20371350
MIRT216668	hsa-miR-515-3p	PAR-CLIP	20371350
MIRT216669	hsa-miR-519e-3p	PAR-CLIP	20371350
MIRT216681	hsa-miR-3659	PAR-CLIP	20371350
MIRT216686	hsa-miR-4706	PAR-CLIP	20371350
MIRT216687	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT571219	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT216678	hsa-miR-3153	PAR-CLIP	20371350
MIRT216690	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT216692	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT216682	hsa-miR-4466	PAR-CLIP	20371350
MIRT216676	hsa-miR-675-5p	PAR-CLIP	20371350
MIRT706041	hsa-miR-186-3p	HITS-CLIP	22927820
MIRT706040	hsa-miR-150-5p	HITS-CLIP	22927820
MIRT706039	hsa-miR-3653-5p	HITS-CLIP	22927820
MIRT706038	hsa-miR-1976	HITS-CLIP	22927820
MIRT706037	hsa-miR-6790-3p	HITS-CLIP	22927820
MIRT706036	hsa-miR-6821-3p	HITS-CLIP	22927820
MIRT706035	hsa-miR-6778-3p	HITS-CLIP	22927820
MIRT706034	hsa-miR-1193	HITS-CLIP	22927820
MIRT706033	hsa-miR-378a-5p	HITS-CLIP	22927820
MIRT706032	hsa-miR-640	HITS-CLIP	22927820
MIRT706031	hsa-miR-6843-3p	HITS-CLIP	22927820
MIRT706030	hsa-miR-6848-3p	HITS-CLIP	22927820
MIRT571222	hsa-miR-3609	PAR-CLIP	20371350
MIRT571221	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT216663	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT216664	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT216660	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT216661	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT216667	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT216671	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT216670	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT216662	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT571220	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT216674	hsa-miR-33b-3p	PAR-CLIP	20371350
MIRT216668	hsa-miR-515-3p	PAR-CLIP	20371350
MIRT216669	hsa-miR-519e-3p	PAR-CLIP	20371350
MIRT216681	hsa-miR-3659	PAR-CLIP	20371350
MIRT216686	hsa-miR-4706	PAR-CLIP	20371350
MIRT216687	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT571219	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT216678	hsa-miR-3153	PAR-CLIP	20371350
MIRT216690	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT216692	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT216682	hsa-miR-4466	PAR-CLIP	20371350
MIRT216676	hsa-miR-675-5p	PAR-CLIP	20371350
MIRT974316	hsa-miR-106a	CLIP-seq
MIRT974317	hsa-miR-106b	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT974319	hsa-miR-150	CLIP-seq
MIRT974320	hsa-miR-17	CLIP-seq
MIRT974321	hsa-miR-1825	CLIP-seq
MIRT974322	hsa-miR-20a	CLIP-seq
MIRT974323	hsa-miR-20b	CLIP-seq
MIRT974324	hsa-miR-2115	CLIP-seq
MIRT974325	hsa-miR-2392	CLIP-seq
MIRT974326	hsa-miR-302a	CLIP-seq
MIRT974327	hsa-miR-302b	CLIP-seq
MIRT974328	hsa-miR-302c	CLIP-seq
MIRT974329	hsa-miR-302d	CLIP-seq
MIRT974330	hsa-miR-302e	CLIP-seq
MIRT974331	hsa-miR-3074-3p	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT974333	hsa-miR-3152-3p	CLIP-seq
MIRT974334	hsa-miR-3176	CLIP-seq
MIRT974335	hsa-miR-3182	CLIP-seq
MIRT974336	hsa-miR-361-5p	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT974338	hsa-miR-372	CLIP-seq
MIRT974339	hsa-miR-373	CLIP-seq
MIRT974340	hsa-miR-3922-3p	CLIP-seq
MIRT974341	hsa-miR-3942-3p	CLIP-seq
MIRT974342	hsa-miR-4263	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT974345	hsa-miR-4438	CLIP-seq
MIRT974346	hsa-miR-4506	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT974348	hsa-miR-4652-3p	CLIP-seq
MIRT974349	hsa-miR-4659a-3p	CLIP-seq
MIRT974350	hsa-miR-4659b-3p	CLIP-seq
MIRT974351	hsa-miR-4662a-5p	CLIP-seq
MIRT974352	hsa-miR-4676-5p	CLIP-seq
MIRT974353	hsa-miR-4731-5p	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT974355	hsa-miR-5095	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT974357	hsa-miR-512-3p	CLIP-seq
MIRT974358	hsa-miR-516a-3p	CLIP-seq
MIRT974359	hsa-miR-519d	CLIP-seq
MIRT974360	hsa-miR-520a-3p	CLIP-seq
MIRT974361	hsa-miR-520b	CLIP-seq
MIRT974362	hsa-miR-520c-3p	CLIP-seq
MIRT974363	hsa-miR-520d-3p	CLIP-seq
MIRT974364	hsa-miR-520e	CLIP-seq
MIRT974365	hsa-miR-520g	CLIP-seq
MIRT974366	hsa-miR-520h	CLIP-seq
MIRT974367	hsa-miR-548aa	CLIP-seq
MIRT974368	hsa-miR-575	CLIP-seq
MIRT974369	hsa-miR-576-5p	CLIP-seq
MIRT974370	hsa-miR-587	CLIP-seq
MIRT974371	hsa-miR-621	CLIP-seq
MIRT974372	hsa-miR-93	CLIP-seq
MIRT974316	hsa-miR-106a	CLIP-seq
MIRT974317	hsa-miR-106b	CLIP-seq
MIRT1556325	hsa-miR-1284	CLIP-seq
MIRT974320	hsa-miR-17	CLIP-seq
MIRT974322	hsa-miR-20a	CLIP-seq
MIRT974323	hsa-miR-20b	CLIP-seq
MIRT1556326	hsa-miR-217	CLIP-seq
MIRT1556327	hsa-miR-4418	CLIP-seq
MIRT1556328	hsa-miR-4793-3p	CLIP-seq
MIRT1556329	hsa-miR-509-3-5p	CLIP-seq
MIRT1556330	hsa-miR-509-5p	CLIP-seq
MIRT974359	hsa-miR-519d	CLIP-seq
MIRT1556331	hsa-miR-519e	CLIP-seq
MIRT1556332	hsa-miR-548ah	CLIP-seq
MIRT974372	hsa-miR-93	CLIP-seq
MIRT974325	hsa-miR-2392	CLIP-seq
MIRT974333	hsa-miR-3152-3p	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT974351	hsa-miR-4662a-5p	CLIP-seq
MIRT974352	hsa-miR-4676-5p	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT974368	hsa-miR-575	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT1988678	hsa-miR-154	CLIP-seq
MIRT1988679	hsa-miR-23a	CLIP-seq
MIRT1988680	hsa-miR-23b	CLIP-seq
MIRT1988681	hsa-miR-23c	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT1988682	hsa-miR-3199	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT1988683	hsa-miR-450b-5p	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT1988684	hsa-miR-4715-3p	CLIP-seq
MIRT1988685	hsa-miR-4722-3p	CLIP-seq
MIRT1988686	hsa-miR-4729	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT1988688	hsa-miR-4740-3p	CLIP-seq
MIRT1988689	hsa-miR-4763-5p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT1988691	hsa-miR-507	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT1988692	hsa-miR-550a	CLIP-seq
MIRT1988693	hsa-miR-552	CLIP-seq
MIRT1988694	hsa-miR-557	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT1988696	hsa-miR-764	CLIP-seq
MIRT2223102	hsa-miR-1267	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT2223103	hsa-miR-1281	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT2223104	hsa-miR-1307	CLIP-seq
MIRT2223105	hsa-miR-1343	CLIP-seq
MIRT974325	hsa-miR-2392	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT1988682	hsa-miR-3199	CLIP-seq
MIRT2223106	hsa-miR-338-5p	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT2223107	hsa-miR-4284	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT2223108	hsa-miR-4534	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT2223109	hsa-miR-4638-5p	CLIP-seq
MIRT1988685	hsa-miR-4722-3p	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT1988688	hsa-miR-4740-3p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT2223110	hsa-miR-4803	CLIP-seq
MIRT2223111	hsa-miR-548ac	CLIP-seq
MIRT2223112	hsa-miR-548ae	CLIP-seq
MIRT2223113	hsa-miR-548aj	CLIP-seq
MIRT2223114	hsa-miR-548am	CLIP-seq
MIRT2223115	hsa-miR-548d-3p	CLIP-seq
MIRT2223116	hsa-miR-548x	CLIP-seq
MIRT2223117	hsa-miR-548z	CLIP-seq
MIRT1988693	hsa-miR-552	CLIP-seq
MIRT2223118	hsa-miR-582-5p	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT2223119	hsa-miR-624	CLIP-seq
MIRT974316	hsa-miR-106a	CLIP-seq
MIRT974317	hsa-miR-106b	CLIP-seq
MIRT2526986	hsa-miR-1245b-5p	CLIP-seq
MIRT2526987	hsa-miR-1248	CLIP-seq
MIRT2526988	hsa-miR-1254	CLIP-seq
MIRT2526989	hsa-miR-1266	CLIP-seq
MIRT974318	hsa-miR-128	CLIP-seq
MIRT2526990	hsa-miR-1289	CLIP-seq
MIRT2526991	hsa-miR-1291	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT2526992	hsa-miR-1301	CLIP-seq
MIRT2526993	hsa-miR-147	CLIP-seq
MIRT974319	hsa-miR-150	CLIP-seq
MIRT974320	hsa-miR-17	CLIP-seq
MIRT974322	hsa-miR-20a	CLIP-seq
MIRT974323	hsa-miR-20b	CLIP-seq
MIRT2526994	hsa-miR-28-3p	CLIP-seq
MIRT974326	hsa-miR-302a	CLIP-seq
MIRT974327	hsa-miR-302b	CLIP-seq
MIRT974328	hsa-miR-302c	CLIP-seq
MIRT974329	hsa-miR-302d	CLIP-seq
MIRT974330	hsa-miR-302e	CLIP-seq
MIRT2526995	hsa-miR-3116	CLIP-seq
MIRT2526996	hsa-miR-3130-5p	CLIP-seq
MIRT974332	hsa-miR-3135b	CLIP-seq
MIRT2526997	hsa-miR-3140-3p	CLIP-seq
MIRT2526998	hsa-miR-3142	CLIP-seq
MIRT2526999	hsa-miR-3180	CLIP-seq
MIRT2527000	hsa-miR-3180-3p	CLIP-seq
MIRT2527001	hsa-miR-3196	CLIP-seq
MIRT2527002	hsa-miR-3198	CLIP-seq
MIRT2527003	hsa-miR-328	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT2527004	hsa-miR-346	CLIP-seq
MIRT2527005	hsa-miR-3622b-5p	CLIP-seq
MIRT974337	hsa-miR-3652	CLIP-seq
MIRT2527006	hsa-miR-3664-3p	CLIP-seq
MIRT2527007	hsa-miR-3664-5p	CLIP-seq
MIRT2527008	hsa-miR-3681	CLIP-seq
MIRT2527009	hsa-miR-3691-5p	CLIP-seq
MIRT974338	hsa-miR-372	CLIP-seq
MIRT974339	hsa-miR-373	CLIP-seq
MIRT974341	hsa-miR-3942-3p	CLIP-seq
MIRT2527010	hsa-miR-3945	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT2527011	hsa-miR-4253	CLIP-seq
MIRT2527012	hsa-miR-4254	CLIP-seq
MIRT2527013	hsa-miR-4266	CLIP-seq
MIRT2527014	hsa-miR-4288	CLIP-seq
MIRT2527015	hsa-miR-4294	CLIP-seq
MIRT2527016	hsa-miR-4297	CLIP-seq
MIRT2527017	hsa-miR-4309	CLIP-seq
MIRT2527018	hsa-miR-4312	CLIP-seq
MIRT974343	hsa-miR-4423-5p	CLIP-seq
MIRT974344	hsa-miR-4430	CLIP-seq
MIRT2527019	hsa-miR-4482	CLIP-seq
MIRT2527020	hsa-miR-4488	CLIP-seq
MIRT1988683	hsa-miR-450b-5p	CLIP-seq
MIRT2527021	hsa-miR-4518	CLIP-seq
MIRT974347	hsa-miR-4634	CLIP-seq
MIRT2527022	hsa-miR-4643	CLIP-seq
MIRT2527023	hsa-miR-4650-5p	CLIP-seq
MIRT2527024	hsa-miR-4660	CLIP-seq
MIRT2527025	hsa-miR-4691-5p	CLIP-seq
MIRT2527026	hsa-miR-4695-5p	CLIP-seq
MIRT2527027	hsa-miR-4697-5p	CLIP-seq
MIRT2527028	hsa-miR-4711-3p	CLIP-seq
MIRT2527029	hsa-miR-4714-5p	CLIP-seq
MIRT1988684	hsa-miR-4715-3p	CLIP-seq
MIRT2527030	hsa-miR-4720-5p	CLIP-seq
MIRT974353	hsa-miR-4731-5p	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT2527031	hsa-miR-4766-5p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT2527032	hsa-miR-4779	CLIP-seq
MIRT2527033	hsa-miR-4787-5p	CLIP-seq
MIRT2527034	hsa-miR-4799-3p	CLIP-seq
MIRT974354	hsa-miR-483-5p	CLIP-seq
MIRT2527035	hsa-miR-494	CLIP-seq
MIRT2527036	hsa-miR-5047	CLIP-seq
MIRT1988691	hsa-miR-507	CLIP-seq
MIRT974356	hsa-miR-5096	CLIP-seq
MIRT974357	hsa-miR-512-3p	CLIP-seq
MIRT974359	hsa-miR-519d	CLIP-seq
MIRT974360	hsa-miR-520a-3p	CLIP-seq
MIRT974361	hsa-miR-520b	CLIP-seq
MIRT974362	hsa-miR-520c-3p	CLIP-seq
MIRT974363	hsa-miR-520d-3p	CLIP-seq
MIRT974364	hsa-miR-520e	CLIP-seq
MIRT974365	hsa-miR-520g	CLIP-seq
MIRT974366	hsa-miR-520h	CLIP-seq
MIRT2527037	hsa-miR-532-5p	CLIP-seq
MIRT1988694	hsa-miR-557	CLIP-seq
MIRT2527038	hsa-miR-576-3p	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT2527039	hsa-miR-599	CLIP-seq
MIRT2527040	hsa-miR-606	CLIP-seq
MIRT2527041	hsa-miR-632	CLIP-seq
MIRT2527042	hsa-miR-642b	CLIP-seq
MIRT2527043	hsa-miR-661	CLIP-seq
MIRT2527044	hsa-miR-873	CLIP-seq
MIRT974372	hsa-miR-93	CLIP-seq
MIRT2526988	hsa-miR-1254	CLIP-seq
MIRT2526990	hsa-miR-1289	CLIP-seq
MIRT1988677	hsa-miR-129-5p	CLIP-seq
MIRT2526994	hsa-miR-28-3p	CLIP-seq
MIRT2526995	hsa-miR-3116	CLIP-seq
MIRT2526996	hsa-miR-3130-5p	CLIP-seq
MIRT2527002	hsa-miR-3198	CLIP-seq
MIRT1922028	hsa-miR-33a	CLIP-seq
MIRT1922029	hsa-miR-33b	CLIP-seq
MIRT2527004	hsa-miR-346	CLIP-seq
MIRT2527008	hsa-miR-3681	CLIP-seq
MIRT2527009	hsa-miR-3691-5p	CLIP-seq
MIRT974341	hsa-miR-3942-3p	CLIP-seq
MIRT1922030	hsa-miR-411	CLIP-seq
MIRT2527012	hsa-miR-4254	CLIP-seq
MIRT2527014	hsa-miR-4288	CLIP-seq
MIRT2527015	hsa-miR-4294	CLIP-seq
MIRT2527017	hsa-miR-4309	CLIP-seq
MIRT2527019	hsa-miR-4482	CLIP-seq
MIRT1988683	hsa-miR-450b-5p	CLIP-seq
MIRT2527025	hsa-miR-4691-5p	CLIP-seq
MIRT2527028	hsa-miR-4711-3p	CLIP-seq
MIRT1988684	hsa-miR-4715-3p	CLIP-seq
MIRT1988687	hsa-miR-4735-5p	CLIP-seq
MIRT1988690	hsa-miR-4775	CLIP-seq
MIRT1988691	hsa-miR-507	CLIP-seq
MIRT1988694	hsa-miR-557	CLIP-seq
MIRT2527038	hsa-miR-576-3p	CLIP-seq
MIRT1988695	hsa-miR-590-3p	CLIP-seq
MIRT2527040	hsa-miR-606	CLIP-seq
MIRT2527041	hsa-miR-632	CLIP-seq
MIRT2527043	hsa-miR-661	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
SP1	Unknown	9494121
SP3	Unknown	9494121
STAT3	Activation	23504318
TFAP2A	Unknown	20805990
TWIST1	Repression	19051271
TWIST2	Repression	19051271

Show/Hide all (94)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0001965	Function	G-protein alpha-subunit binding	ISS
GO:0002248	Process	Connective tissue replacement involved in inflammatory response wound healing	IDA	9639571
GO:0003105	Process	Negative regulation of glomerular filtration	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	ISS
GO:0004930	Function	G protein-coupled receptor activity	TAS	17848177
GO:0005102	Function	Signaling receptor binding	IPI	1672265
GO:0005515	Function	Protein binding	IPI	17299037, 17848177, 20164183, 20826780, 22547407, 24732013
GO:0005576	Component	Extracellular region	TAS
GO:0005769	Component	Early endosome	IDA	22547407, 24732013
GO:0005770	Component	Late endosome	IDA	24732013
GO:0005794	Component	Golgi apparatus	TAS	7961693
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9038223, 22547407
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	1672265
GO:0005901	Component	Caveola	IDA	17848177
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	20164183
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007529	Process	Establishment of synaptic specificity at neuromuscular junction	ISS
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10692450
GO:0009611	Process	Response to wounding	IDA	9639571
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9701242
GO:0009986	Component	Cell surface	IDA	24732013
GO:0014047	Process	Glutamate secretion	ISS
GO:0015057	Function	Thrombin-activated receptor activity	IBA
GO:0015057	Function	Thrombin-activated receptor activity	IDA	1672265, 10692450
GO:0015057	Function	Thrombin-activated receptor activity	IEA
GO:0015057	Function	Thrombin-activated receptor activity	TAS	9038223
GO:0016020	Component	Membrane	IEA
GO:0030168	Process	Platelet activation	IDA	9038223
GO:0030193	Process	Regulation of blood coagulation	IDA	17848177
GO:0030194	Process	Positive regulation of blood coagulation	IBA
GO:0030194	Process	Positive regulation of blood coagulation	IDA	9038223
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	9701242
GO:0031094	Component	Platelet dense tubular network	IDA	9038223
GO:0031594	Component	Neuromuscular junction	ISS
GO:0031681	Function	G-protein beta-subunit binding	IEA
GO:0031681	Function	G-protein beta-subunit binding	ISS
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032651	Process	Regulation of interleukin-1 beta production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	11447194
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	17404307
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	9639571
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IEA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	ISS
GO:0036145	Process	Dendritic cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	10692450
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	17848177
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0045211	Component	Postsynaptic membrane	ISS
GO:0045217	Process	Cell-cell junction maintenance	IMP	23202369
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	17848177
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	ISS
GO:0045987	Process	Positive regulation of smooth muscle contraction	ISS
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	NAS	10692450
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	ISS
GO:0051209	Process	Release of sequestered calcium ion into cytosol	ISS
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	1672265
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051928	Process	Positive regulation of calcium ion transport	ISS
GO:0060155	Process	Platelet dense granule organization	IC	1672265
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IDA	1672265
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0070493	Process	Thrombin-activated receptor signaling pathway	IEA
GO:0099553	Process	Trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IEA
GO:1900134	Process	Negative regulation of renin secretion into blood stream	IEA
GO:1900134	Process	Negative regulation of renin secretion into blood stream	ISS

MIM	HGNC	e!Ensembl
187930	3537	ENSG00000181104

P25116

Protein name

Proteinase-activated receptor 1 (PAR-1) (Coagulation factor II receptor) (Thrombin receptor)

Protein function

High affinity receptor that binds the activated thrombin, leading to calcium release from intracellular stores (PubMed:1672265, PubMed:8136362). The thrombin-activated receptor signaling pathway is mediated through PTX-insensitive G proteins, ac

PDB

1NRN , 1NRO , 1NRP , 1NRQ , 1NRR , 3BEF , 3HKI , 3HKJ , 3LU9 , 3VW7 , 8XOR , 8XOS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	119 → 371	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Platelets and vascular endothelial cells.

Sequence

MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT

Sequence length

425

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Calcium signaling pathway cAMP signaling pathway Phospholipase D signaling pathway Neuroactive ligand-receptor interaction PI3K-Akt signaling pathway Complement and coagulation cascades Platelet activation Regulation of actin cytoskeleton Pathogenic Escherichia coli infection Pathways in cancer		Common Pathway of Fibrin Clot Formation Peptide ligand-binding receptors G alpha (q) signalling events Thrombin signalling through proteinase activated receptors (PARs)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC PERSISTENT HEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
F2R-related disorder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (331)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
5q-syndrome	5q-syndrome	BEFREE	8602997, 9373191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	22459907, 30065181, 30526198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28282218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	27819671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28173772, 28187035, 30196987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	26238780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	20101173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11964083, 18366077, 31048498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30152921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19350118, 28122028, 30152921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	25163932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aganglionosis, Colonic	Colonic Aganglionosis	BEFREE	24489901, 30219229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	29182653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	6302135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	8395910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31048498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28088683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28088683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12676802, 1328304, 29622563, 30310081, 30511258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	24385683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18787303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12589358, 26120939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12676802, 1328304, 29622563, 30310081, 30511258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	12805069, 23740526, 35742805, 36430902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27992120, 28747025, 29378352, 29801760, 30017860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28747025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	12192616, 30074224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	33442040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28222093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11287624		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28447716		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	28282218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	28187035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	16245281, 18386288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20333728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	30076949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	16091733, 29166373, 30716426, 8632823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	24973402, 26278396, 30891029, 34235728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	16194864, 22212092, 22459907, 26556638, 28747025, 35054966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	24156029	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	23832758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	18387137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	25901734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19622587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11964083, 12637343, 16510585, 18372913, 18757438, 19538737, 19622769, 21799402, 21822552, 22291441, 22593082, 24009311, 24177339, 26513020, 26600192 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11278329, 14966279, 17470200, 26165842, 26244666, 26392299, 29348172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20056842, 21622534, 22086466, 37486532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12645337, 15455382, 16875721, 9070649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16434963, 19749797, 20146079, 21622534, 21909684, 29195126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26968954	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	31962001	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21703428, 22573325, 25861627, 27566553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28148395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33932087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19407221, 21622534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15455382, 21093894, 28148395, 29848718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	9392328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	16202218	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26278396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	14559973, 28400806, 31595195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12563316, 28256580, 28443061, 29343482, 30718498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	14961162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28202519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	25163932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12645337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	21037076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	24489901, 29855113, 30219229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestatic liver disease	Cholestatic liver disease	BEFREE	21037076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	15917349, 21289002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	24612435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21216163, 28282218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12589358, 24973402, 26535635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	26564991		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	31397331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28296821, 31539206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12707033, 15383630, 25846512, 31846381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12707033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12707033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	12707033, 17164780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25119598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12707033, 20056842, 21907696, 24284797, 25119598, 25846512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	29019057, 8602997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21289002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23517743, 28282218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10972534, 16194864, 17347481, 19806256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10972534, 16194864, 17347481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	16194864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16194864, 17347481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	11514372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18832729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28296821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	22581587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21905006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	24462335, 28645747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30353092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26564991, 31759113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23740526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26564991, 31759113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29774092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26564991, 27489245, 31287960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37415174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28929122, 29774092, 31287960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	21591259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	16597678, 21057178, 22071895, 22791839, 25056248, 9140395, 9254856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	21515911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	LHGDN	12594292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	21622534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16875721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15755869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15755869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31793425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28088683, 30391321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21093894, 28148395, 29848718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	21557443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19424642, 29977156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19424642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25297082	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22086466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25297082	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	20008134, 21907177, 22841818		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	18005014, 21037076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	21037076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	22993310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	19969492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	28670703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20462964, 22497886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22682129, 24790104, 26616854, 30619047, 31715381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20462964, 22682129, 24790104, 26616854, 30619047, 31715381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26616854, 30619047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32507767	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28282218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	16285898	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	25806575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Graves ophthalmopathy	Pubtator	25806575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	30662428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	28282218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	24612435, 30055940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	35302736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	8638607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	25163932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	12008957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	37552109, 6302135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HOYERAAL-HREIDARSSON SYNDROME	Hoyeraal-Hreidarsson Syndrome	BEFREE	12833411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28155585, 30955248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	22228373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	37947652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30423156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	9721728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	9721728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	37947652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35853902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19060230, 19652365, 23919450, 28139758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	19844076, 22246002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20442298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	25539146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	16951492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	15545995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28296821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	23280128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	11447011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	30152921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29529042, 29554016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25032959, 26084674, 29343482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29110957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34115025, 37965310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Langer Mesomelic Dysplasia Syndrome	Langer Mesomelic Dysplasia Syndrome	BEFREE	17394206, 24311385		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	16202218	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	26367014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	26367014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leri-Weill dyschondrosteosis	Leri-Weill Dyschondrosteosis	BEFREE	16175500, 16941489, 17394206, 20412871, 21147883, 22020182, 22071895, 22791839, 24311385		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21216163, 22187047, 24740120, 27819671, 30076949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21216163, 30076949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21216163	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27258612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21216163, 27819671, 28282218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12645337, 16003238, 17323377, 25353287, 25373316, 28187035, 28758812, 28834900, 30081924, 30196987, 30383541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17323377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	18005014		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	21037076		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	17323377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	15563688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	15563688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	21703428, 28173772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25861627, 27566553, 28173772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16575839, 28883515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18507028, 39363900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22086466	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	31227779, 31243313, 33686511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	20333728		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	20333728		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	20333728		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	20333728		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	20333728		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	20333728		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	20333728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11964083, 16510585, 18372913, 18757438, 19538737, 21799402, 21822552, 22291441, 22593082, 24009311, 24177339, 26513020, 26600192, 27094683, 30822721, 31420608 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16875721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19424642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21703428, 22573325, 25861627, 27566553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15455382, 29848718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11964083, 23293110, 24436106, 28182192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12429291, 16245281, 16530725, 17373694, 17942914, 19170048, 19795418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20723226, 21966428, 22993310, 25231630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11964083, 15455382, 16091733, 16875721, 19170048, 19795418, 19941475, 21557443, 21799402, 22682129, 23242308, 23517743, 23921961, 24009311, 24405508 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12707033, 15383630, 25846512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18757438, 22593082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25163932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25163932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12789289, 15492257, 18974154, 19679555, 21378407, 22009534, 24405508		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12789289, 16021575, 16946713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12975361, 21993564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16946713, 19679555, 19703903, 34373558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	12926518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	24462335, 28645747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25364818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	25364818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25364818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30989650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	12789289, 18974154, 25505176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micropenis	Micropenis	BEFREE	22581587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19809478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	10952021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11468178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28655310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	28655310, 33086557, 34207429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28262842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	8602997, 9373191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	34343137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21216163, 30076949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19404549, 27489245, 28565918, 31271083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	37940228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	23391721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	11161707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22562397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11395381, 11468178, 11964083, 12023846, 12554695, 12645337, 15625067, 15925089, 16091733, 16707447, 17323377, 17374729, 18372913, 18974154, 19424642 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30683917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30683917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28222093, 30385861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	29019057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23548249, 28173772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30989650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	37486532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30989650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	18048360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31420608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15455382		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15455382, 29848718		★★★★★ ★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	25460576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11964083, 23293110, 24436106, 28182192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	11964083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	24436106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23293110, 23555989, 24699825, 33932087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	23555989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16410750, 30185553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	BEFREE	22581587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	26564991, 31175838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26564991, 28120492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	23740526	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	24913105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	28565918, 30039419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	28565918, 30039419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	18507028, 6302135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	17924967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32323770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	20131237, 28883515, 29102762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	28465646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	11258349, 8630505, 8755558, 8845846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	19641190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28282218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	22833386, 26247679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12429291, 16245281, 16530725, 17373694, 17942914, 19170048, 19795418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	18386288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12534282, 12883880, 17373694, 18308730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16052512, 17492768, 19170048, 28510269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16245281, 30152921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	23024298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12645829, 24973402, 26278396, 26535635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	19307611, 29722565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	12023853, 15563688, 15821019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17532472, 19060230, 23739922, 24842054, 25689283, 28469072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	25539146, 25612863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	8602997, 9373191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23517743, 28282218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	35410372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20442298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21905006, 7554443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	26278396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	26278396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	31420608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12782970, 15893580, 19352591, 27974147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	19350118, 21591259, 25032959, 28957875, 29343482, 29514266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	23675494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	21993564, 23675494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	23494654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	23832758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15625067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28173772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32536459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23548249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15625067		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29274308, 30716426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28088683, 30391321, 30515700, 31667526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	20008134, 21907177, 22841818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20723226, 21966428, 22993310, 25231630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 18507028, 19622587, 20723226, 24817013, 36438913, 38291086	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29922213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	26189554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11407697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	16194864, 33086557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	29851288, 30257802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	25934730, 32507767, 33086557, 8395910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	39363900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid hormone resistance	Pubtator	19299458, 25867808, 36191835, 7913468, 9804773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
THYROID HORMONE RESISTANCE, GENERALIZED, AUTOSOMAL DOMINANT	Thyroid Hormone Resistance	BEFREE	8421105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance, Generalized, Autosomal Recessive	Thyroid Hormone Resistance	BEFREE	8421105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	34115025	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32034579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	10931762, 16650979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33558481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37486532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30310081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	31230554, 34873055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	16606835, 17170365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	19552680	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	19552680, 27761580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	18224254		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Dyskeratosis Congenita	Dyskeratosis Congenita, X-Linked	BEFREE	12833411		★★★★★ ★☆☆☆☆ Found in Text Mining only
XX males	XX Males	BEFREE	12782970		★★★★★ ★☆☆☆☆ Found in Text Mining only

F2R (coagulation factor II thrombin receptor)