Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	214
Gene name	Activated leukocyte cell adhesion molecule
Gene symbol	ALCAM
Synonyms (NCBI Gene)	CD166MEMD
Chromosome	3
Chromosome location	3q13.11
Summary	This gene encodes activated leukocyte cell adhesion molecule (ALCAM), also known as CD166 (cluster of differentiation 166), which is a member of a subfamily of immunoglobulin receptors with five immunoglobulin-like domains (VVC2C2C2) in the extracellular

289

Show/Hide all (289)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004163	hsa-miR-192-5p	Microarray	16822819
MIRT024327	hsa-miR-215-5p	Microarray	19074876
MIRT004163	hsa-miR-192-5p	Microarray	19074876
MIRT053167	hsa-miR-148b-3p	Luciferase reporter assayqRT-PCRWestern blot	23667173
MIRT053167	hsa-miR-148b-3p	Luciferase reporter assayqRT-PCRWestern blot	23667173
MIRT053167	hsa-miR-148b-3p	Luciferase reporter assayqRT-PCRWestern blot	23667173
MIRT004163	hsa-miR-192-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21119604
MIRT004163	hsa-miR-192-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21119604
MIRT024327	hsa-miR-215-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21119604
MIRT024327	hsa-miR-215-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21119604
MIRT437958	hsa-miR-483-5p	Luciferase reporter assay	24710410
MIRT437958	hsa-miR-483-5p	Luciferase reporter assay	24710410
MIRT437958	hsa-miR-483-5p	Luciferase reporter assay	24710410
MIRT437958	hsa-miR-483-5p	Luciferase reporter assay	24710410
MIRT441237	hsa-miR-323a-5p	HITS-CLIP	24374217
MIRT441237	hsa-miR-323a-5p	HITS-CLIP	24374217
MIRT437958	hsa-miR-483-5p	Luciferase reporter assayWestern blottingMicroarrayImmunohistochemistry (IHC)qRT-PCRIn situ hybridizationin vivo gain/loss-of-function experiments	24710410
MIRT004163	hsa-miR-192-5p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	38717494
MIRT776868	hsa-miR-1238	CLIP-seq
MIRT776869	hsa-miR-1269	CLIP-seq
MIRT776870	hsa-miR-1269b	CLIP-seq
MIRT776871	hsa-miR-205	CLIP-seq
MIRT776872	hsa-miR-2277-3p	CLIP-seq
MIRT776873	hsa-miR-342-3p	CLIP-seq
MIRT776874	hsa-miR-3660	CLIP-seq
MIRT776875	hsa-miR-377	CLIP-seq
MIRT776876	hsa-miR-3940-5p	CLIP-seq
MIRT776877	hsa-miR-4256	CLIP-seq
MIRT776878	hsa-miR-4282	CLIP-seq
MIRT776879	hsa-miR-4297	CLIP-seq
MIRT776880	hsa-miR-4317	CLIP-seq
MIRT776881	hsa-miR-4507	CLIP-seq
MIRT776882	hsa-miR-4520b-3p	CLIP-seq
MIRT776883	hsa-miR-4526	CLIP-seq
MIRT776884	hsa-miR-4529-3p	CLIP-seq
MIRT776885	hsa-miR-4643	CLIP-seq
MIRT776886	hsa-miR-4659a-3p	CLIP-seq
MIRT776887	hsa-miR-4659b-3p	CLIP-seq
MIRT776888	hsa-miR-4715-3p	CLIP-seq
MIRT776889	hsa-miR-4778-3p	CLIP-seq
MIRT776890	hsa-miR-513a-3p	CLIP-seq
MIRT776891	hsa-miR-548c-3p	CLIP-seq
MIRT776892	hsa-miR-548g	CLIP-seq
MIRT776893	hsa-miR-593	CLIP-seq
MIRT776894	hsa-miR-629	CLIP-seq
MIRT1555906	hsa-miR-297	CLIP-seq
MIRT1555907	hsa-miR-3924	CLIP-seq
MIRT776878	hsa-miR-4282	CLIP-seq
MIRT1555908	hsa-miR-4677-3p	CLIP-seq
MIRT1555909	hsa-miR-4679	CLIP-seq
MIRT1555910	hsa-miR-4711-3p	CLIP-seq
MIRT1555911	hsa-miR-4796-5p	CLIP-seq
MIRT1555912	hsa-miR-561	CLIP-seq
MIRT1555913	hsa-miR-567	CLIP-seq
MIRT1555914	hsa-miR-586	CLIP-seq
MIRT776868	hsa-miR-1238	CLIP-seq
MIRT776878	hsa-miR-4282	CLIP-seq
MIRT776890	hsa-miR-513a-3p	CLIP-seq
MIRT776891	hsa-miR-548c-3p	CLIP-seq
MIRT1929413	hsa-miR-1273e	CLIP-seq
MIRT1929414	hsa-miR-1276	CLIP-seq
MIRT1929415	hsa-miR-1321	CLIP-seq
MIRT1929416	hsa-miR-148a	CLIP-seq
MIRT1929417	hsa-miR-148b	CLIP-seq
MIRT1929418	hsa-miR-152	CLIP-seq
MIRT1929419	hsa-miR-223	CLIP-seq
MIRT1929420	hsa-miR-3162-5p	CLIP-seq
MIRT1929421	hsa-miR-3166	CLIP-seq
MIRT1929422	hsa-miR-34b	CLIP-seq
MIRT776878	hsa-miR-4282	CLIP-seq
MIRT1929423	hsa-miR-4328	CLIP-seq
MIRT1929424	hsa-miR-4697-3p	CLIP-seq
MIRT1929425	hsa-miR-4739	CLIP-seq
MIRT1929426	hsa-miR-4756-5p	CLIP-seq
MIRT1929427	hsa-miR-4771	CLIP-seq
MIRT1929428	hsa-miR-4795-3p	CLIP-seq
MIRT1555911	hsa-miR-4796-5p	CLIP-seq
MIRT1929429	hsa-miR-488	CLIP-seq
MIRT1555912	hsa-miR-561	CLIP-seq
MIRT2169967	hsa-miR-1206	CLIP-seq
MIRT2169968	hsa-miR-1234	CLIP-seq
MIRT776868	hsa-miR-1238	CLIP-seq
MIRT2169969	hsa-miR-124	CLIP-seq
MIRT2169970	hsa-miR-1261	CLIP-seq
MIRT776869	hsa-miR-1269	CLIP-seq
MIRT776870	hsa-miR-1269b	CLIP-seq
MIRT2169971	hsa-miR-1273d	CLIP-seq
MIRT1929413	hsa-miR-1273e	CLIP-seq
MIRT2169972	hsa-miR-1307	CLIP-seq
MIRT2169973	hsa-miR-1324	CLIP-seq
MIRT2169974	hsa-miR-138	CLIP-seq
MIRT1929416	hsa-miR-148a	CLIP-seq
MIRT1929417	hsa-miR-148b	CLIP-seq
MIRT1929418	hsa-miR-152	CLIP-seq
MIRT2169975	hsa-miR-1911	CLIP-seq
MIRT2169976	hsa-miR-198	CLIP-seq
MIRT2169977	hsa-miR-2053	CLIP-seq
MIRT1929419	hsa-miR-223	CLIP-seq
MIRT2169978	hsa-miR-2682	CLIP-seq
MIRT1555906	hsa-miR-297	CLIP-seq
MIRT2169979	hsa-miR-299-5p	CLIP-seq
MIRT2169980	hsa-miR-302a	CLIP-seq
MIRT2169981	hsa-miR-302b	CLIP-seq
MIRT2169982	hsa-miR-302c	CLIP-seq
MIRT2169983	hsa-miR-302d	CLIP-seq
MIRT2169984	hsa-miR-302e	CLIP-seq
MIRT2169985	hsa-miR-3120-3p	CLIP-seq
MIRT2169986	hsa-miR-3122	CLIP-seq
MIRT2169987	hsa-miR-3126-3p	CLIP-seq
MIRT2169988	hsa-miR-3137	CLIP-seq
MIRT2169989	hsa-miR-3145-5p	CLIP-seq
MIRT2169990	hsa-miR-3148	CLIP-seq
MIRT2169991	hsa-miR-3163	CLIP-seq
MIRT1929421	hsa-miR-3166	CLIP-seq
MIRT2169992	hsa-miR-338-5p	CLIP-seq
MIRT2169993	hsa-miR-345	CLIP-seq
MIRT2169994	hsa-miR-34a	CLIP-seq
MIRT2169995	hsa-miR-34c-5p	CLIP-seq
MIRT2169996	hsa-miR-3615	CLIP-seq
MIRT2169997	hsa-miR-3665	CLIP-seq
MIRT2169998	hsa-miR-3675-3p	CLIP-seq
MIRT2169999	hsa-miR-3681	CLIP-seq
MIRT2170000	hsa-miR-3689a-3p	CLIP-seq
MIRT2170001	hsa-miR-3689a-5p	CLIP-seq
MIRT2170002	hsa-miR-3689b	CLIP-seq
MIRT2170003	hsa-miR-3689c	CLIP-seq
MIRT2170004	hsa-miR-3689e	CLIP-seq
MIRT2170005	hsa-miR-3689f	CLIP-seq
MIRT2170006	hsa-miR-3714	CLIP-seq
MIRT2170007	hsa-miR-372	CLIP-seq
MIRT2170008	hsa-miR-373	CLIP-seq
MIRT2170009	hsa-miR-3910	CLIP-seq
MIRT2170010	hsa-miR-3913-5p	CLIP-seq
MIRT2170011	hsa-miR-3921	CLIP-seq
MIRT1555907	hsa-miR-3924	CLIP-seq
MIRT2170012	hsa-miR-3934	CLIP-seq
MIRT2170013	hsa-miR-3977	CLIP-seq
MIRT2170014	hsa-miR-4251	CLIP-seq
MIRT776878	hsa-miR-4282	CLIP-seq
MIRT2170015	hsa-miR-4287	CLIP-seq
MIRT2170016	hsa-miR-4303	CLIP-seq
MIRT2170017	hsa-miR-4307	CLIP-seq
MIRT1929423	hsa-miR-4328	CLIP-seq
MIRT2170018	hsa-miR-4329	CLIP-seq
MIRT2170019	hsa-miR-4423-3p	CLIP-seq
MIRT2170020	hsa-miR-4456	CLIP-seq
MIRT2170021	hsa-miR-4470	CLIP-seq
MIRT2170022	hsa-miR-4477a	CLIP-seq
MIRT2170023	hsa-miR-4477b	CLIP-seq
MIRT2170024	hsa-miR-449a	CLIP-seq
MIRT2170025	hsa-miR-449b	CLIP-seq
MIRT2170026	hsa-miR-449c	CLIP-seq
MIRT776882	hsa-miR-4520b-3p	CLIP-seq
MIRT2170027	hsa-miR-4522	CLIP-seq
MIRT2170028	hsa-miR-4524	CLIP-seq
MIRT776884	hsa-miR-4529-3p	CLIP-seq
MIRT2170029	hsa-miR-4638-5p	CLIP-seq
MIRT2170030	hsa-miR-4645-3p	CLIP-seq
MIRT2170031	hsa-miR-4652-3p	CLIP-seq
MIRT2170032	hsa-miR-4653-5p	CLIP-seq
MIRT2170033	hsa-miR-4666-3p	CLIP-seq
MIRT1555908	hsa-miR-4677-3p	CLIP-seq
MIRT1555909	hsa-miR-4679	CLIP-seq
MIRT2170034	hsa-miR-4682	CLIP-seq
MIRT2170035	hsa-miR-4685-3p	CLIP-seq
MIRT2170036	hsa-miR-4690-5p	CLIP-seq
MIRT2170037	hsa-miR-4693-3p	CLIP-seq
MIRT2170038	hsa-miR-4694-3p	CLIP-seq
MIRT1929424	hsa-miR-4697-3p	CLIP-seq
MIRT1555910	hsa-miR-4711-3p	CLIP-seq
MIRT2170039	hsa-miR-4732-5p	CLIP-seq
MIRT2170040	hsa-miR-4746-5p	CLIP-seq
MIRT2170041	hsa-miR-4762-3p	CLIP-seq
MIRT1929427	hsa-miR-4771	CLIP-seq
MIRT2170042	hsa-miR-4775	CLIP-seq
MIRT2170043	hsa-miR-4778-5p	CLIP-seq
MIRT2170044	hsa-miR-4780	CLIP-seq
MIRT2170045	hsa-miR-4785	CLIP-seq
MIRT2170046	hsa-miR-4788	CLIP-seq
MIRT2170047	hsa-miR-4789-5p	CLIP-seq
MIRT1929428	hsa-miR-4795-3p	CLIP-seq
MIRT1555911	hsa-miR-4796-5p	CLIP-seq
MIRT2170048	hsa-miR-491-3p	CLIP-seq
MIRT2170049	hsa-miR-499-3p	CLIP-seq
MIRT2170050	hsa-miR-499a-3p	CLIP-seq
MIRT2170051	hsa-miR-506	CLIP-seq
MIRT776890	hsa-miR-513a-3p	CLIP-seq
MIRT2170052	hsa-miR-519a	CLIP-seq
MIRT2170053	hsa-miR-519b-3p	CLIP-seq
MIRT2170054	hsa-miR-519c-3p	CLIP-seq
MIRT2170055	hsa-miR-520a-3p	CLIP-seq
MIRT2170056	hsa-miR-520a-5p	CLIP-seq
MIRT2170057	hsa-miR-520b	CLIP-seq
MIRT2170058	hsa-miR-520c-3p	CLIP-seq
MIRT2170059	hsa-miR-520d-3p	CLIP-seq
MIRT2170060	hsa-miR-520d-5p	CLIP-seq
MIRT2170061	hsa-miR-520e	CLIP-seq
MIRT2170062	hsa-miR-522	CLIP-seq
MIRT2170063	hsa-miR-524-5p	CLIP-seq
MIRT2170064	hsa-miR-525-5p	CLIP-seq
MIRT2170065	hsa-miR-544	CLIP-seq
MIRT2170066	hsa-miR-548ac	CLIP-seq
MIRT2170067	hsa-miR-548ae	CLIP-seq
MIRT2170068	hsa-miR-548aj	CLIP-seq
MIRT2170069	hsa-miR-548am	CLIP-seq
MIRT776891	hsa-miR-548c-3p	CLIP-seq
MIRT2170070	hsa-miR-548d-3p	CLIP-seq
MIRT2170071	hsa-miR-548x	CLIP-seq
MIRT2170072	hsa-miR-548z	CLIP-seq
MIRT2170073	hsa-miR-553	CLIP-seq
MIRT1555912	hsa-miR-561	CLIP-seq
MIRT1555913	hsa-miR-567	CLIP-seq
MIRT2170074	hsa-miR-568	CLIP-seq
MIRT2170075	hsa-miR-569	CLIP-seq
MIRT2170076	hsa-miR-582-5p	CLIP-seq
MIRT1555914	hsa-miR-586	CLIP-seq
MIRT2170077	hsa-miR-590-3p	CLIP-seq
MIRT2170078	hsa-miR-600	CLIP-seq
MIRT2170079	hsa-miR-601	CLIP-seq
MIRT2170080	hsa-miR-622	CLIP-seq
MIRT2170081	hsa-miR-623	CLIP-seq
MIRT2170082	hsa-miR-639	CLIP-seq
MIRT2170083	hsa-miR-654-3p	CLIP-seq
MIRT2384062	hsa-miR-767-3p	CLIP-seq
MIRT776868	hsa-miR-1238	CLIP-seq
MIRT2472857	hsa-miR-1256	CLIP-seq
MIRT776869	hsa-miR-1269	CLIP-seq
MIRT776870	hsa-miR-1269b	CLIP-seq
MIRT2472858	hsa-miR-2276	CLIP-seq
MIRT776872	hsa-miR-2277-3p	CLIP-seq
MIRT776873	hsa-miR-342-3p	CLIP-seq
MIRT776875	hsa-miR-377	CLIP-seq
MIRT2472859	hsa-miR-3908	CLIP-seq
MIRT776876	hsa-miR-3940-5p	CLIP-seq
MIRT2472860	hsa-miR-3942-5p	CLIP-seq
MIRT2170013	hsa-miR-3977	CLIP-seq
MIRT2472861	hsa-miR-4260	CLIP-seq
MIRT2472862	hsa-miR-4261	CLIP-seq
MIRT776878	hsa-miR-4282	CLIP-seq
MIRT776881	hsa-miR-4507	CLIP-seq
MIRT776882	hsa-miR-4520b-3p	CLIP-seq
MIRT776884	hsa-miR-4529-3p	CLIP-seq
MIRT776885	hsa-miR-4643	CLIP-seq
MIRT2472863	hsa-miR-4703-5p	CLIP-seq
MIRT2472864	hsa-miR-4712-3p	CLIP-seq
MIRT776888	hsa-miR-4715-3p	CLIP-seq
MIRT2472865	hsa-miR-4766-3p	CLIP-seq
MIRT2472866	hsa-miR-4772-3p	CLIP-seq
MIRT2472867	hsa-miR-486-3p	CLIP-seq
MIRT776890	hsa-miR-513a-3p	CLIP-seq
MIRT2472868	hsa-miR-539	CLIP-seq
MIRT2170065	hsa-miR-544	CLIP-seq
MIRT776891	hsa-miR-548c-3p	CLIP-seq
MIRT1555912	hsa-miR-561	CLIP-seq
MIRT2472869	hsa-miR-618	CLIP-seq
MIRT2472870	hsa-miR-628-5p	CLIP-seq
MIRT776894	hsa-miR-629	CLIP-seq
MIRT2674884	hsa-miR-1	CLIP-seq
MIRT776868	hsa-miR-1238	CLIP-seq
MIRT776869	hsa-miR-1269	CLIP-seq
MIRT776870	hsa-miR-1269b	CLIP-seq
MIRT2674885	hsa-miR-206	CLIP-seq
MIRT776872	hsa-miR-2277-3p	CLIP-seq
MIRT2674886	hsa-miR-323-3p	CLIP-seq
MIRT776873	hsa-miR-342-3p	CLIP-seq
MIRT2674887	hsa-miR-3647-3p	CLIP-seq
MIRT776875	hsa-miR-377	CLIP-seq
MIRT776876	hsa-miR-3940-5p	CLIP-seq
MIRT2674888	hsa-miR-409-3p	CLIP-seq
MIRT2472862	hsa-miR-4261	CLIP-seq
MIRT776878	hsa-miR-4282	CLIP-seq
MIRT2674889	hsa-miR-4289	CLIP-seq
MIRT776881	hsa-miR-4507	CLIP-seq
MIRT776882	hsa-miR-4520b-3p	CLIP-seq
MIRT776884	hsa-miR-4529-3p	CLIP-seq
MIRT776885	hsa-miR-4643	CLIP-seq
MIRT2472864	hsa-miR-4712-3p	CLIP-seq
MIRT776890	hsa-miR-513a-3p	CLIP-seq
MIRT2674890	hsa-miR-514	CLIP-seq
MIRT2674891	hsa-miR-514b-3p	CLIP-seq
MIRT2472868	hsa-miR-539	CLIP-seq
MIRT776891	hsa-miR-548c-3p	CLIP-seq
MIRT776892	hsa-miR-548g	CLIP-seq
MIRT2674892	hsa-miR-581	CLIP-seq
MIRT2674893	hsa-miR-591	CLIP-seq
MIRT776893	hsa-miR-593	CLIP-seq
MIRT2674894	hsa-miR-613	CLIP-seq
MIRT2472869	hsa-miR-618	CLIP-seq
MIRT776894	hsa-miR-629	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IDA	15294938
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005102	Function	Signaling receptor binding	TAS	7760007
GO:0005515	Function	Protein binding	IPI	24945728, 26146185, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15294938
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	ISS
GO:0007155	Process	Cell adhesion	TAS	7760007
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	16352806
GO:0007165	Process	Signal transduction	TAS	7760007
GO:0007411	Process	Axon guidance	IEA
GO:0008045	Process	Motor neuron axon guidance	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0031290	Process	Retinal ganglion cell axon guidance	ISS
GO:0042101	Component	T cell receptor complex	IDA	15294938
GO:0042802	Function	Identical protein binding	IPI	26146185
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0048846	Process	Axon extension involved in axon guidance	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:1990138	Process	Neuron projection extension	ISS

MIM	HGNC	e!Ensembl
601662	400	ENSG00000170017

Q13740

Protein name

CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)

Protein function

Cell adhesion molecule that mediates both heterotypic cell-cell contacts via its interaction with CD6, as well as homotypic cell-cell contacts (PubMed:15048703, PubMed:15496415, PubMed:16352806, PubMed:23169771, PubMed:24945728, PubMed:7760007).

PDB

5A2F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08205	C2-set_2	137 → 231	CD80-like C2-set immunoglobulin domain	Domain
PF13927	Ig_3	249 → 316		Domain

Tissue specificity

TISSUE SPECIFICITY: Detected on hematopoietic stem cells derived from umbilical cord blood (PubMed:24740813). Detected on lymph vessel endothelial cells, skin and tonsil (PubMed:23169771). Detected on peripheral blood monocytes (PubMed:15048703). Detected

Sequence

MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEK
PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDN
VFEAPTIVKVFKQPSKPEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPL
EGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKADIQMPFTCSVTYYGPSGQKTIHSEQAVF
DIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTL
TDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASR
NATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEEN
VTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAA
LVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA

Sequence length

583

Interactions

View interactions

	KEGG
	Cell adhesion molecules

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (188)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	31835039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	27062566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24710410, 25881239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	21630083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	21430457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	25472586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	22562538, 26990997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	29755662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	24491301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	25472586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30051179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	25472586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28461772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10693872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24311777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29394080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28461772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28760953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18279810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27894096, 29453336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	32321465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	24302539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16810131, 16865058, 18202807, 20530423, 20736952, 20929568, 20972617, 21293922, 21935604, 22555284, 25255861, 25270339, 26923994, 27130882, 28063929, 29315254, 30905597 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	15318930, 16484444, 20364042, 22791584, 22983139, 26923994, 28754978, 29315254, 31757997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18202807, 25255861	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34641959	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21430457, 22941204, 23840677, 29315254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15532095, 20972617		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	25472586	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	21430457	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21572107, 24482231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	25472586	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27894096, 29453336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25512094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	21430457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18171982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21757661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30688187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	15380042, 24966904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31835039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25987048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25987048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondromyxoid fibroma	Chondromyxoid Fibroma	BEFREE	17559135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	25738923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21640118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27062566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	19010307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17548814, 23539446, 23980595, 26990997, 28464221, 28537909, 28969077, 29755662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15509676	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18279810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19010307, 20135722, 20606680, 20630067, 23539446, 24023782, 25665511, 26990997, 27062566, 27507615, 32158188, 32608200, 32647988, 35016698, 37103072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	31757032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30051179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29755662, 30784924		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Craniopharyngioma	Craniopharyngioma	BEFREE	28709442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24237425, 24819053, 27155399, 28805694, 29728632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	36634823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	31332979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22704111, 28325697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22704111, 28325697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22704111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28325697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28325697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	20972617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	25420915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	21430457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31332979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27873306, 29682175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	18171982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	24891117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	22704111		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16024937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16024937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	31140328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	30292090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	26318430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	26318430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	36614319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22166264, 24302539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22166264, 24302539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28279658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30051179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	26318430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	27894096	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	36159854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18070985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	21430457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28521775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30395204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27018499	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	BEFREE	28622532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30395204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	21757661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23840677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26004137, 29375378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36159854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	28521775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28822802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	35774777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15318930	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35016698	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28279658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	22722789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16810131, 16865058, 18202807, 20530423, 20736952, 20929568, 20972617, 21293922, 21935604, 22555284, 25255861, 25270339, 26923994, 27130882, 28063929, 29315254, 30905597 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27873306, 29682175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16024937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	26318430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24482231, 24891117, 25094049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25512094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23840677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25221999, 27573419, 29533466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16865058, 24385212, 31695844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21119604, 25395097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27894096, 29453336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17559135, 20635083, 20736952, 20929568, 21364949, 21640118, 22304788, 22318386, 22745734, 22985775, 23035753, 23840677, 23903875, 24385212, 24501004 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21640118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16865058, 18172759, 18279810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26923994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	21364949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	29678478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10702391, 15509676, 17143262, 22318386, 26134500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15140234, 16204050, 16865058, 22318386, 23667173, 29678478, 9502422		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15140234, 18279810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	26134500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28811252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	28811252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	28811252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23975165	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Diseases	Mouth disease	Pubtator	23840677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	23840677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	25472586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26755711, 27634757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26755711, 32321465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34592762	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23507476, 25216742, 26844569, 28273717, 31723036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29533466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31835039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28968954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16024937, 16810131, 18171982, 20530423, 20635083, 20929568, 21430457, 21640118, 21935604, 22304788, 22745734, 23903875, 24385212, 24501004, 24708484 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	20208136, 34116676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27466504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	29678478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22985775, 24501004, 26531053, 29845263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23975165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14609532, 24819053, 29728632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27155399	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28805694	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondritis Dissecans	Osteochondritis Dissecans	BEFREE	29998134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30995926		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18171982, 18347173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25221999, 27573419, 29533466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19603023, 22745698, 27573419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36614319	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	22745698, 27573419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21364949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36634823	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritonitis	Peritonitis	Pubtator	36614319	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	28599054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16865058, 24385212, 31695844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	37705744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12481253, 18279810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15509676, 16982673, 24385212, 35767366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26736064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	24708484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	22940369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26844569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	25472586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	25472586, 35848479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	31140328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30688187		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	LHGDN	16024937, 18279810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16024937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23840677, 29507910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23903875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21119604, 25395097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21119604	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21364949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	21364949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30905597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	27813511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	27573419	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22475274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	22745734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22745734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ALCAM (activated leukocyte cell adhesion molecule)