EWSR1 (EWS RNA binding protein 1)

Gene

• Entrez ID: 2130
• Gene name: EWS RNA binding protein 1
• Gene symbol: EWSR1
• Synonyms (NCBI Gene): EWS, EWS-FLI1
• Chromosome: 22
• Chromosome location: 22q12.2
• Summary: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006152	hsa-let-7a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21853155
MIRT006152	hsa-let-7a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21853155
MIRT006152	hsa-let-7a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21853155
MIRT006152	hsa-let-7a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21853155
MIRT006152	hsa-let-7a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21853155
MIRT006152	hsa-let-7a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21853155
MIRT051778	hsa-let-7c-5p	CLASH	23622248
MIRT048593	hsa-miR-100-5p	CLASH	23622248
MIRT048183	hsa-miR-196a-5p	CLASH	23622248
MIRT046333	hsa-miR-23b-3p	CLASH	23622248
MIRT045611	hsa-miR-149-5p	CLASH	23622248
MIRT044493	hsa-miR-320a	CLASH	23622248
MIRT044051	hsa-miR-362-5p	CLASH	23622248
MIRT043753	hsa-miR-328-3p	CLASH	23622248
MIRT042515	hsa-miR-423-3p	CLASH	23622248
MIRT040046	hsa-miR-615-3p	CLASH	23622248
MIRT037136	hsa-miR-877-3p	CLASH	23622248
MIRT972361	hsa-miR-340	CLIP-seq
MIRT972362	hsa-miR-3688-3p	CLIP-seq
MIRT972363	hsa-miR-513a-3p	CLIP-seq
MIRT972364	hsa-miR-3144-3p	CLIP-seq
MIRT972365	hsa-miR-3941	CLIP-seq
MIRT972366	hsa-miR-409-3p	CLIP-seq
MIRT972367	hsa-miR-466	CLIP-seq
MIRT972368	hsa-miR-4672	CLIP-seq
MIRT972369	hsa-miR-4731-3p	CLIP-seq
MIRT972370	hsa-miR-4777-5p	CLIP-seq
MIRT972371	hsa-miR-4801	CLIP-seq
MIRT972372	hsa-miR-496	CLIP-seq
MIRT972373	hsa-miR-518d-5p	CLIP-seq
MIRT972374	hsa-miR-519b-5p	CLIP-seq
MIRT972375	hsa-miR-519c-5p	CLIP-seq
MIRT972376	hsa-miR-520c-5p	CLIP-seq
MIRT972377	hsa-miR-526a	CLIP-seq
MIRT972378	hsa-miR-875-5p	CLIP-seq
MIRT972366	hsa-miR-409-3p	CLIP-seq
MIRT2448988	hsa-miR-1178	CLIP-seq
MIRT2448989	hsa-miR-3936	CLIP-seq
MIRT2448990	hsa-miR-4457	CLIP-seq
MIRT2448991	hsa-miR-513b	CLIP-seq
MIRT2448988	hsa-miR-1178	CLIP-seq
MIRT2526100	hsa-miR-1252	CLIP-seq
MIRT2526101	hsa-miR-1264	CLIP-seq
MIRT2526102	hsa-miR-2053	CLIP-seq
MIRT972361	hsa-miR-340	CLIP-seq
MIRT972362	hsa-miR-3688-3p	CLIP-seq
MIRT2526103	hsa-miR-3926	CLIP-seq
MIRT2448989	hsa-miR-3936	CLIP-seq
MIRT972366	hsa-miR-409-3p	CLIP-seq
MIRT2448990	hsa-miR-4457	CLIP-seq
MIRT2526104	hsa-miR-4474-3p	CLIP-seq
MIRT2526105	hsa-miR-4528	CLIP-seq
MIRT972363	hsa-miR-513a-3p	CLIP-seq
MIRT2448991	hsa-miR-513b	CLIP-seq
MIRT2526106	hsa-miR-548s	CLIP-seq
MIRT2526107	hsa-miR-663b	CLIP-seq
MIRT2448988	hsa-miR-1178	CLIP-seq
MIRT2526100	hsa-miR-1252	CLIP-seq
MIRT2526101	hsa-miR-1264	CLIP-seq
MIRT2526102	hsa-miR-2053	CLIP-seq
MIRT2680376	hsa-miR-299-5p	CLIP-seq
MIRT972361	hsa-miR-340	CLIP-seq
MIRT972362	hsa-miR-3688-3p	CLIP-seq
MIRT2526103	hsa-miR-3926	CLIP-seq
MIRT2448989	hsa-miR-3936	CLIP-seq
MIRT972366	hsa-miR-409-3p	CLIP-seq
MIRT2448990	hsa-miR-4457	CLIP-seq
MIRT2526104	hsa-miR-4474-3p	CLIP-seq
MIRT2526105	hsa-miR-4528	CLIP-seq
MIRT972363	hsa-miR-513a-3p	CLIP-seq
MIRT2448991	hsa-miR-513b	CLIP-seq
MIRT2526106	hsa-miR-548s	CLIP-seq
MIRT2526107	hsa-miR-663b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	8084618
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 18320585, 18347058, 18509338, 21988832, 23455924, 23975937, 25416956, 25910212, 29892012, 31515488, 32814053
GO:0005516	Function	Calmodulin binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0015030	Component	Cajal body	IEA
GO:0016020	Component	Membrane	IEA
GO:0042802	Function	Identical protein binding	IPI	21988832, 23975937
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 133450
• HGNC: 3508
• e!Ensembl: ENSG00000182944

Protein

• UniProt ID: Q01844
• Protein name: RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein)
• Protein function: Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3' (PubMed:21256132). Might normally function as a transcriptional repressor (PubMed:10767297). EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb ge
• PDB: 2CPE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	363 → 441	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00641	zf-RanBP	518 → 549	Zn-finger in Ran binding protein and others	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT
  YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT
  QPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
  MQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
  PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR
  GRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDN
  SAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDP
  PTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGP
  GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTEC
  NQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFR
  GGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY

• Sequence length: 656

Pathways

KEGG:

Transcriptional misregulation in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar ClinGen, Disgenet, GenCC ClinGen, Disgenet, GenCC	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ANGIOMATOID FIBROUS HISTIOCYTOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESMOPLASTIC SMALL ROUND CELL TUMOR	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ewing sarcoma	Benign	ClinVar ClinVar, HPO ClinVar, HPO ClinVar, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
EWSR1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXTRASKELETAL EWING SARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXTRASKELETAL MYXOID CHONDROSARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA OF SOFT TISSUE	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOMA, EWING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKELETAL EWING SARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	12359745		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18383210		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	21484932, 22510762, 23426124, 25359601, 25581728, 25805066, 27769871, 27916624, 28009602, 28930752		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	25990369		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	31812440		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	19704258, 20231617, 23185447		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28630030	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	17016721, 29034595, 30285997		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21856723, 22454397, 24011641, 25960086, 27311318, 28389532, 29425503, 29731676, 30209068, 30481590, 31171724		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GENOMICS_ENGLAND_DG	22454397		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	26573619, 31171724, 37722062	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	21438137		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	33293370	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	33293370	Stimulate	★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	19725831, 28382842		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	33012788	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	36555836	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	15729702, 17482132, 22986530, 23480895, 24993903, 29431183, 31164960		★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	34310785, 37478161	Associate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	32970137	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33378126	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23637631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	12086853, 22081015, 23527175, 23940108, 25737553, 30068701, 36041632, 40131773	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23715163, 24378390, 25581728, 26768122, 28236059, 31050844, 31139520		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	29309308, 31443718, 38050902	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	38010473	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34612781	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22350795, 28946910, 29076874, 29434341, 30047065, 31782119, 32720034, 33827033, 34099871, 34251595, 35165059, 37479138	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	34374640	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29076874	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	28296680, 29285586		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	33378126, 34099871	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral Primitive Neuroectodermal Tumor	Cerebral Primitive Neuroectodermal Tumor	CTD_human_DG	12162413		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	31812440		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	10359536, 18162764, 18587326, 19775727, 26808135, 7539287		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	18587326		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	31020999	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	18587326, 18855877, 21128778, 24508382, 24746215, 27832806, 28141799, 29924341, 30895378, 31020999, 36948401, 9060841	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	31994243	Associate	★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	LHGDN	11992546		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	15884099, 16189150, 16258500, 16327442, 17000668, 17724745, 18094413, 18300804, 19561568, 19620941, 20087159, 20712646, 21128778, 21212061, 22045652, 22406360, 22559980, 22886438, 23228147, 23399793, 23953591, 23980901, 25312298, 25446247, 27109316, 28009602, 28141799, 29661713, 30155908, 30219084, 31139520, 31276279, 8187063, 8223458, 8401579, 8552387, 9824209		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	ORPHANET_DG	19561568		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30481590		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28630030	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17108118, 25930744, 30951563		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	12377657, 15183454, 15826834, 20495444, 23657987, 8287228		★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	30819530		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23117075, 31430493, 31774608		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	36690805	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	34251595	Associate	★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	BEFREE	10029456, 10430278, 10555010, 10989634, 11237525, 11896622, 12131150, 12296765, 12498718, 12640103, 12923058, 14648792, 15166674, 15354743, 15389255, 15826834, 16730884, 16930335, 17021139, 17425400, 18523561, 18703217, 19263077, 20739766, 22162435, 22215508, 22420726, 24321497, 24486246, 24639098, 24832162, 24953786, 27180056, 28141799, 28166781, 28325870, 28748349, 29626752, 29661713, 29871905, 31103034, 7495283, 7530783, 8187063, 8522311, 8702614, 9071577, 9344317, 9591781, 9646031, 9706984, 9797782, 9949226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	10838070, 11406651, 12296765, 12923058, 15389255, 16189150, 17425400, 18523561, 21128778, 21212061, 23922674, 23994981, 24517889, 25119929, 27428733, 27568672, 27863505, 28141799, 28188619, 28233365, 28325870, 28522325, 29871905, 30379650, 30895378, 31837177, 32393201, 33753552, 34350470, 35821028, 36656211, 37960784, 7495283, 8040301, 8702614	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Desmoplastic small round cell tumor	Desmoplastic Tumor	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea	Diarrhea	Pubtator	35858740	Associate	★☆☆☆☆ Found in Text Mining only
Elejalde Disease	Hereditary elliptocytosis	Pubtator	10638960	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	19837262		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	38010473	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoblastoma	Ependymoblastoma	CTD_human_DG	12162413		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	26763770		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	20617339		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	25375143		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	25375143	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	10078922, 10084692, 10088552, 10197607, 10221334, 10470089, 10493837, 10508522, 10553162, 10561219, 10574242, 10623711, 10637511, 10638960, 10749119, 10749123, 10810459, 10897036, 10951342, 10975680, 10980604, 10982695, 11002425, 11051226, 11118299, 11140696, 11304041, 11313995, 11406651, 11423975, 11431376, 11441341, 11474174, 11507040, 11550284, 11890993, 12086853, 12377657, 12432241, 12527902, 12557222, 12560386, 12606131, 12736494, 12788655, 12907633, 14550555, 14563122, 14678994, 14681687, 14973077, 14977835, 15183454, 15188147, 15282325, 15342383, 15346053, 15492248, 15500943, 15659501, 15735734, 15748890, 15782144, 15826833, 15899394, 15919668, 15930281, 16052075, 16083345, 16189150, 16202544, 16206264, 16217257, 16303180, 16394125, 16463269, 16556028, 16697960, 16837212, 16849546, 16865286, 16969112, 17016721, 17047047, 17047056, 17108118, 17114343, 17154184, 17163154, 17163841, 17202261, 17334332, 17403624, 17425403, 17431644, 17438102, 17453169, 17482132, 17557870, 17610475, 17620387, 17700534, 18064647, 18256529, 18295659, 18330902, 18338330, 18381423, 18413612, 18591936, 18615675, 18623202, 18626011, 18677114, 18757425, 18925858, 18927503, 19151750, 19243895, 19282832, 19305498, 19417137, 19491900, 19502792, 19528446, 19642105, 19704258, 19718047, 19920188, 20023231, 20049929, 20308673, 20418671, 20472912, 20490332, 20513536, 20543858, 20547696, 20633768, 20648560, 20691659, 21085683, 21113140, 21128778, 21212061, 21217773, 21244633, 21267687, 21559405, 21643012, 21768330, 21793187, 21853155, 21872822, 21926473, 21942527, 21979944, 22022506, 22080479, 22323082, 22429598, 22446943, 22460902, 22723308, 22749036, 22910415, 22925827, 22930730, 22971270, 23015660, 23079205, 23085431, 23145994, 23178492, 23313578, 23441188, 23452988, 23480895, 23508900, 23527175, 23579072, 23706910, 23857410, 23935076, 23995784, 24033704, 24112992, 24124617, 24158076, 24277455, 24294922, 24318733, 24362521, 24378390, 24481407, 24667836, 24723486, 24735198, 24812032, 24846856, 24898918, 24911143, 24963049, 24974828, 24993903, 24999758, 25093581, 25119929, 25162919, 25186949, 25303625, 25387699, 25453903, 25483190, 25517742, 25625846, 25662499, 25688366, 25712098, 25723116, 25737553, 25751255, 25779942, 25925574, 26056084, 26193259, 26214589, 26313223, 26336820, 26337082, 26393682, 26455317, 26462019, 26616853, 26623725, 26659003, 26690869, 26776507, 26802024, 26847175, 26961871, 26966980, 26969300, 26979396, 27006472, 27166877, 27191748, 27256563, 27259270, 27283964, 27317769, 27363011, 27375017, 27500883, 27557498, 27697767, 27740934, 27760381, 27783944, 27875302, 27918348, 28030800, 28062706, 28134926, 28135250, 28141799, 28188619, 28346326, 28452858, 28643791, 28671673, 28720588, 28735378, 28748349, 28775288, 28902354, 28938120, 29034595, 29059150, 29091716, 29285586, 29328472, 29416716, 29513652, 29581854, 29626598, 29654955, 29873416, 29898995, 29945296, 29950716, 30031766, 30053180, 30068701, 30093639, 30106161, 30114371, 30123424, 30131386, 30140378, 30257034, 30348635, 30353686, 30470587, 30481590, 30496486, 30642852, 30700749, 30741933, 30819134, 30845695, 30895378, 30926641, 30994538, 31025088, 31036566, 31107830, 31155838, 31207107, 31275859, 31392992, 31431459, 31511320, 31550266, 31577941, 31649319, 31756779, 31788090, 31811703, 31831298, 7517940, 7524975, 7544579, 7591257, 7656205, 7700648, 7738717, 7882340, 7887445, 8040301, 8076344, 8086619, 8162068, 8164678, 8187063, 8187069, 8246959, 8287228, 8307570, 8336942, 8401579, 8510758, 8516324, 8522311, 8617485, 8625264, 8644855, 8648380, 8707406, 8834175, 8875708, 9000139, 9005992, 9049825, 9050923, 9052984, 9053480, 9071576, 9121764, 9242212, 9286296, 9488465, 9495359, 9496833, 9500772, 9524226, 9552022, 9622091, 9646031, 9646032, 9741544, 9798675, 9811331, 9858836		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	CTD_human_DG	16646077, 26214589, 27006472		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	10078922, 10209495, 10492040, 10493837, 10565682, 10623711, 10989634, 11037342, 11118299, 11178636, 11261815, 11304041, 11313995, 11471459, 11519035, 11679946, 12557222, 12683899, 12883251, 14973077, 15049010, 15492248, 15877528, 15930281, 16157025, 16196395, 16258512, 16944972, 17126256, 17272319, 17487851, 17557870, 17610475, 17990934, 18223324, 18591936, 18622580, 19411158, 19801966, 20231617, 20513536, 20660338, 21063743, 21113140, 21979944, 22365564, 22420726, 22429598, 23117075, 23165331, 24158076, 24293381, 25303625, 27766786, 27984122, 28296680, 29034595, 30474100, 31831298, 7495283, 7506981, 7524604, 7591257, 7675766, 7738717, 7882340, 8022439, 8040301, 8084618, 8238248, 8287228, 8577710, 8617485, 8644855, 8875708, 9049824, 9178886, 9224742, 9495359, 9496833, 9508202, 9559290, 9622091, 9646032, 9704926, 9741544, 9836070		★☆☆☆☆ Found in Text Mining only
Extra-osseous Ewing`s sarcoma	Extra-Osseous Ewing`s Sarcoma	ORPHANET_DG	21113140		★☆☆☆☆ Found in Text Mining only
Extraskeletal Ewing sarcoma	Extraskeletal Ewing Sarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	10410173, 10537274, 10895826, 11679947, 12049818, 12378528, 12543801, 15188455, 15212958, 15262426, 16112421, 18162764, 18330902, 18580682, 18587326, 18855877, 21212061, 22592656, 22743288, 22804337, 23588370, 24508382, 24746215, 25581728, 28141799, 28383167, 30776935, 30994538, 31020999, 7635565, 9060841, 9781944		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	ORPHANET_DG	18855877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal myxoid chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eye Neoplasms	Eye Neoplasms	BEFREE	10030577		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Thyroid cancer	Pubtator	33692755	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	25875009, 28591699		★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	18162764		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12447693, 12557222, 15846078, 25990776		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	30209068, 30481590, 31171724		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	31171724	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	24011641, 27903134, 30755280		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	26810070		★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	27506465		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	20418671		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	35858740	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	17403624		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	10897036		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	24993903	Associate	★☆☆☆☆ Found in Text Mining only
Gilbert Disease	Gilbert syndrome	Pubtator	37097347	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33378126, 35731869	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28912153, 29679497	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24993038	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	37742928	Stimulate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	32970137	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	26763770		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	36916425	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma Angiomatoid Fibrous	Angiomatoid fibrous histiocytoma	Pubtator	19801966, 21822206, 22038502, 28281318, 30642852, 30895378, 32970137, 34193943, 36593607	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	15884099, 17724745, 18094413, 18300800, 18422688, 18666823, 19801966, 22038502, 22588066, 24614712, 25804255, 25927151, 28009602, 28141799, 28248724, 28281318, 29432314, 29932283, 30819530, 30831299, 31139520, 31567275, 31652145		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Benign Fibrous	Benign fibrous histiocytoma	LHGDN	17724745		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	12377657	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20442286, 23579072	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32049009	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	12721254, 31443718		★☆☆☆☆ Found in Text Mining only
Ileus	Ileus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11431376		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	30819530		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	17126256, 18615675, 24896634, 9559290		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	25875009, 28591699	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	17325488		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12359745		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12908547, 26462019, 27627705, 8187069, 9178886		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18620564	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27627705, 9315104		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	16884691, 17586092, 21344536		★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	12169678, 20581806, 21128778, 21212061, 25393000, 30895378, 32341520, 32362012, 32815829, 33459994, 33731886, 34971481, 35115049, 35713256, 38335254	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	31443718		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	12169678, 15492825, 16538055, 16884691, 17586092, 17647282, 18162764, 21128778, 22570737, 26865464, 28141799, 31774608, 7533529, 8637704, 9306965, 9315104		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	30398641	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25134518		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32504289	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	7656205		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	21793187, 24999758, 26336820		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	21793187, 22080479		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	31443718		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	28505004		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17108118, 25134518		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27783944		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	27783944		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	31036566		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10078922, 12923058, 15748890, 17690209, 18677114, 18850010, 21853155, 22287547, 22930730, 23441188, 23857410, 24033704, 24158095, 24294922, 24378390, 24667836, 25186949, 25387699, 25483190, 25517742, 26462019, 26979396, 27351911, 28062706, 28720588, 29871905, 30496486, 31036566, 31072811, 31189996, 31810195		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	31812440		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10565682		★☆☆☆☆ Found in Text Mining only
Mandibular Neoplasms	Mandibular Neoplasms	BEFREE	28559020		★☆☆☆☆ Found in Text Mining only
Mediastinal lymphadenopathy	Mediastinal lymphadenopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Medulloepithelioma	Medulloepithelioma	CTD_human_DG	12162413		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16258500, 18300804, 19620941, 20087159, 20712646, 21128778, 22045652, 22406360, 23637631, 30155908		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23637631	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Amelanotic	Melanoma	Pubtator	24274261	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma of soft tissue	Melanoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	23165331		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23630070		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	34193943, 35665561, 37400148	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	28505004, 34121509	Associate	★☆☆☆☆ Found in Text Mining only
Microphthalmia syndromic 7	Microphthalmia	Pubtator	12169678, 25393000	Associate	★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	18752119, 8637704, 9315104		★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	25483190, 33293370	Associate	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	22081015	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	22038920, 29072181	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	18338330		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35045690	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	19837262		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	12169678, 12876210, 16884691, 17647282, 18162764, 22570737, 25393000, 26865464, 28141799, 7533529, 8637704, 9306965		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10078922, 10084692, 10209495, 10379685, 10467330, 10492040, 10496592, 10523827, 10565682, 10623711, 10749119, 10951341, 10951342, 10976720, 10980604, 10989634, 10999739, 11118299, 11140696, 11431376, 11550284, 11679946, 11768778, 11815873, 11823984, 12049818, 12086853, 12162413, 12183411, 12296765, 12432241, 12447693, 12504654, 12543801, 12554523, 12557222, 12560328, 12883251, 15049010, 15166674, 15188147, 15212958, 15273724, 15389255, 15491164, 15492248, 15704649, 15748890, 15826833, 15826834, 15846078, 15877528, 15884099, 15919668, 15929128, 15974803, 16083345, 16157025, 16202544, 16394125, 16424012, 16463269, 16556028, 16697960, 16849546, 16941013, 16944972, 17047056, 17126256, 17403624, 17414105, 17525681, 17557870, 18088234, 18162764, 18338330, 18615675, 18622580, 18757425, 18769338, 18838963, 18850010, 19013896, 19150107, 19214114, 19491900, 19704258, 19738075, 19783720, 19801966, 20049929, 20087159, 20153576, 20203285, 20204716, 20308669, 20418671, 20633761, 20633768, 20648560, 20660338, 20815032, 20979180, 21106507, 21128778, 21181413, 21212061, 21267687, 21344536, 21484932, 21653923, 21962892, 21979944, 21984123, 22154050, 22162435, 22266186, 22287547, 22420726, 22508822, 22510762, 22743288, 22879388, 22971270, 23117075, 23365673, 23399793, 23426124, 23480895, 23552387, 23579072, 23588365, 23630011, 23657987, 23681076, 23715163, 23750284, 23857410, 23953591, 24213312, 24293381, 24294922, 24300529, 24667836, 24746215, 24898918, 24911143, 24993903, 25010205, 25092916, 25162919, 25186949, 25231134, 25231231, 25453903, 25454478, 25517742, 25625846, 25706482, 25751255, 25804255, 25805066, 25927151, 26163185, 26165403, 26393682, 26455317, 26462019, 26523541, 26623725, 26768122, 26847175, 26885691, 26966980, 27010880, 27166877, 27180056, 27218413, 27283964, 27317769, 27351911, 27385661, 27627705, 27697767, 27863505, 28009602, 28141799, 28236059, 28281318, 28296680, 28346326, 28423517, 28522325, 28720588, 28946910, 29043531, 29076874, 29152060, 29220288, 29285586, 29309308, 29431183, 29513652, 29533464, 29626598, 29626752, 29661713, 29788195, 29873416, 29957732, 29975250, 30140378, 30257034, 30285997, 30348635, 30379650, 30429005, 30470587, 30496486, 30552521, 30776935, 30819134, 30834570, 31107830, 31164960, 31232935, 31276279, 31430493, 31652145, 31688004, 31697442, 31810195, 31831298, 7530783, 7591257, 7636623, 7656205, 7882340, 8040301, 8084618, 8164678, 8187063, 8522311, 8637704, 8834175, 8875710, 8921363, 9052984, 9071576, 9121764, 9149753, 9496833, 9500772, 9508202, 9552022, 9591781, 9702401, 9704926, 9738572, 9824209, 9858836, 9989842		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10989634, 10999739, 11001824, 11960373, 12923058, 15166674, 17021139, 21793187, 24832162, 29626752, 31103034, 8187063, 8522311, 9071577		★☆☆☆☆ Found in Text Mining only
Nerve Sheath Tumors	Nerve Sheath Tumors	BEFREE	29661713		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	30642852		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11423975, 14973077, 15492248, 16944972, 29212266, 29661713, 31709724, 9052984, 9135495		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25375143	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22454397, 27903134, 28453628, 29731676		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	10623711, 10975680, 11002425, 11118299, 11178636, 11261815, 11304041, 12883251, 15919668, 17610475, 18223324, 19074838, 20648560, 21063743, 21128778, 22365564, 24158076, 24486246, 28296680, 29034595, 31831298, 7591257, 8040301, 8084618, 8086619, 8246959, 8516324, 9005992, 9224742, 9488465, 9500772, 9559290, 9798675		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	CTD_human_DG	12162413		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	8307570		★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	23715163		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19642105, 21403840, 25387699, 26997645		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27352193	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32124419, 34461940, 35486030, 36690805	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28236059		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	36083250	Associate	★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	36593607	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	32770123, 35665561	Associate	★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	30209068		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	20049929		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	18383210, 19656640, 29661713		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27783944, 31831298		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23940108, 32915889	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	27783944		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31430493, 31774608		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	18271016		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	29661713		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15342383, 15930281, 17334332, 17431644, 18622580, 30720533		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	30720533, 32504289, 33382123, 38168093	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	23185447, 24517889	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	18338330, 20051954, 34261344	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	27769871		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	10448117, 10602519, 10949935, 11896622, 12721254, 12908547, 14678994, 15183454, 15884099, 15974803, 16730884, 16837212, 17250957, 17272319, 17403624, 17487851, 18580682, 19205734, 19396640, 19837262, 19936782, 20418671, 20648560, 21872822, 21962892, 21997693, 22072439, 22510762, 22743288, 22766791, 23128393, 23252871, 23588368, 23588370, 24293381, 24320889, 24378390, 24723486, 24993903, 25300797, 25446247, 26386605, 26462019, 26685084, 26997645, 27627705, 27865462, 28009602, 28141799, 28166781, 28474974, 29491075, 29533464, 29661713, 29679497, 30106161, 30379650, 30775024, 30895378, 30994538, 31189996, 7493135, 7530783, 7539287, 7882340, 8040301, 8187063, 8238248, 8604338, 8834175, 8921363, 9000139, 9060841, 9071577, 9858836		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	LHGDN	12527902, 15282325, 15919668, 16327442, 17638877, 18414662, 18580682, 18648544, 18974141, 19074838, 19144156		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	15183454, 18620564, 19404404, 24993903, 25300797, 25870707, 25914746, 29104083, 30379650, 30895378, 31171724, 31189996, 31645347, 31972596, 32115849, 32327700, 33012788, 33459994, 33859361, 33987888, 34099871, 34193943, 34417833, 35182012, 36555836, 36928336, 38168093, 38189436, 8890175, 8921363	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	37742928	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Clear Cell	Sarcoma	Pubtator	10574952, 11826187, 16189150, 16258500, 16867224, 19561568, 20087159, 21128778, 24168510, 25880253, 28141799, 29072181, 30219084, 30895378, 33478436, 34193943, 34350470, 34759454, 35347249, 35476996, 35477713, 36041632, 36959380, 37405123	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	10638960, 10702401, 10827180, 10866799, 11140696, 12086853, 12186432, 12377657, 12459554, 12736494, 14550555, 14760098, 15183454, 15282325, 15919668, 16100468, 16189150, 16721801, 16864960, 17334332, 17342771, 17482132, 17620387, 17690209, 17923745, 18212050, 18271016, 18310898, 18338330, 18347058, 18626011, 18757425, 18838963, 19074838, 19144156, 19150107, 19151750, 19247449, 19305498, 19404404, 19528446, 19722745, 19859563, 19920188, 20308669, 20382729, 20442286, 20933505, 21113140, 21128778, 21217773, 21267687, 21403840, 21458383, 21559395, 21643012, 21844121, 21853155, 21926473, 22022506, 22460902, 22723308, 22742646, 22749036, 22907727, 22925827, 23185447, 23313578, 23441188, 23527175, 23579072, 23638178, 23894528, 23922674, 23935076, 23940108, 24293381, 24517889, 24667836, 24675777, 24723486, 24812032, 24963049, 24993903, 24999758, 25092916, 25119929, 25223734, 25401475, 25432018, 25483190, 25603314, 25608963, 25625846, 25704812, 25712098, 25737553, 25751255, 25755803, 25779942, 25870707, 25914746, 26336820, 26455317, 26776507, 26847175, 26929321, 26961871, 27282934, 27317769, 27336789, 27352193, 27506465, 27766786, 27875302, 28030800, 28134926, 28141799, 28188619, 28296680, 28346326, 28429277, 28473430, 28474974, 28542597, 28643791, 28671673, 28720588, 28731043, 28775288, 28844694, 28847958, 28974650, 29091716, 29285586, 29358035, 29513652, 29580035, 29873416, 30068701, 30093639, 30106161, 30114371, 30166462, 30285997, 30319719, 30496486, 30642852, 30819134, 30895378, 31036566, 31392992, 31645347, 31756779, 31810195, 31870501, 31880317, 32016454, 32049009, 32115849, 32323788, 32362012, 32502203, 32658189, 32842875, 32881892, 33097530, 33293370, 33486963, 33741715, 33766983, 33930311, 34009296, 34073779, 34145397, 34350470, 34448796, 34612781, 34749732, 35088879, 35220407, 35298000, 35426856, 35486030, 35550257, 35653119, 35705030, 35739280, 35803262, 35921177, 35952322, 36042341, 36124657, 36129618, 36194562, 36401481, 36476851, 36495678, 36615603, 36656211, 36658219, 36787739, 37097293, 37243594, 37298283, 37372318, 37468459, 37478161, 37511533, 37567448, 38177639, 38335254, 38395409, 38492239, 38511874, 39201282, 39285408, 39367409, 40131773, 40478628, 40666501, 7524604, 7599072, 7887445, 8022439, 8040301, 8063945, 8164678, 8223458, 8238248, 8604338, 8644855, 8921363, 9005992, 9660765, 9738976, 9741544	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	11406651, 37119253	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23145994	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma of kidney	Sarcoma Of Kidney	BEFREE	24896634		★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	11406651	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	29580035, 34504309	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	10951342, 31686193		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28575814, 29337035		★☆☆☆☆ Found in Text Mining only
Skeletal Ewing sarcoma	Skeletal Ewing Sarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	19656640, 29661713		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	11679946, 18338330, 19212622, 19936782, 20815032, 22192800, 23329308, 24320889, 24378390, 25693574, 26847175, 27385661, 28141799, 29626598, 29932283, 30994538, 31025088, 31275859, 31400091, 31686193, 9344317		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	30819530		★☆☆☆☆ Found in Text Mining only
Spongioblastoma	Spongioblastoma	CTD_human_DG	12162413		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	12721254, 31443718		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	20660338, 21403840, 22743288, 24846856, 27180056, 28735509, 30416685		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Thymus Neoplasms	BEFREE	31050844		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	33692755	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34374640	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28236059		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36916425	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	25875009, 28591699		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34310785	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Malformation Primary Intraosseous	Vascular malformation	Pubtator	30720533	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Malformations	Vascular malformation	Pubtator	34081036	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	24277455		★☆☆☆☆ Found in Text Mining only