Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	2128
Gene name	Even-skipped homeobox 1
Gene symbol	EVX1
Synonyms (NCBI Gene)	EVX-1
Chromosome	7
Chromosome location	7p15.2
Summary	This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as

Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT513585	hsa-miR-3936	PAR-CLIP	23446348
MIRT513586	hsa-miR-4436b-3p	PAR-CLIP	23446348
MIRT513584	hsa-miR-4632-5p	PAR-CLIP	23446348
MIRT513583	hsa-miR-6735-5p	PAR-CLIP	23446348
MIRT513582	hsa-miR-6879-5p	PAR-CLIP	23446348
MIRT513581	hsa-miR-7843-5p	PAR-CLIP	23446348
MIRT513580	hsa-miR-4761-3p	PAR-CLIP	23446348
MIRT513579	hsa-miR-764	PAR-CLIP	23446348
MIRT513578	hsa-miR-3179	PAR-CLIP	23446348
MIRT513576	hsa-miR-3665	PAR-CLIP	23446348
MIRT513577	hsa-miR-3202	PAR-CLIP	23446348
MIRT513575	hsa-miR-4747-5p	PAR-CLIP	23446348
MIRT513574	hsa-miR-5196-5p	PAR-CLIP	23446348
MIRT513573	hsa-miR-6721-5p	PAR-CLIP	23446348
MIRT513572	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT513585	hsa-miR-3936	PAR-CLIP	23446348
MIRT513586	hsa-miR-4436b-3p	PAR-CLIP	23446348
MIRT513584	hsa-miR-4632-5p	PAR-CLIP	23446348
MIRT513583	hsa-miR-6735-5p	PAR-CLIP	23446348
MIRT513582	hsa-miR-6879-5p	PAR-CLIP	23446348
MIRT513581	hsa-miR-7843-5p	PAR-CLIP	23446348
MIRT513580	hsa-miR-4761-3p	PAR-CLIP	23446348
MIRT513579	hsa-miR-764	PAR-CLIP	23446348
MIRT513578	hsa-miR-3179	PAR-CLIP	23446348
MIRT513576	hsa-miR-3665	PAR-CLIP	23446348
MIRT513577	hsa-miR-3202	PAR-CLIP	23446348
MIRT513575	hsa-miR-4747-5p	PAR-CLIP	23446348
MIRT513574	hsa-miR-5196-5p	PAR-CLIP	23446348
MIRT513573	hsa-miR-6721-5p	PAR-CLIP	23446348
MIRT513572	hsa-miR-6890-5p	PAR-CLIP	23446348

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	1684419
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0009792	Process	Embryo development ending in birth or egg hatching	IEA
GO:0030424	Component	Axon	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0097377	Process	Spinal cord interneuron axon guidance	IEA
GO:1904936	Process	Interneuron migration	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
142996	3506	ENSG00000106038

P49640

Protein name

Homeobox even-skipped homolog protein 1 (EVX-1)

Protein function

May play a role in the specification of neuronal cell types.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	184 → 240	Homeodomain	Domain

Sequence

MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRER
GGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFY
EEIEVSCTPDCATGNAEYQHSKGSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSAS
DQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKR
QRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPF
SGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCLACHSGPANGL
APRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPLTR

Sequence length

407

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33836755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26552663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26552663	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22596233, 23159584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22596233, 23414321, 26552663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23159584, 26552663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22596233, 23159584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22596233, 23159584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	26552663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26552663		★★★★★ ★☆☆☆☆ Found in Text Mining only

EVX1 (even-skipped homeobox 1)