EVI2B (ecotropic viral integration site 2B)

Gene

• Entrez ID: 2124
• Gene name: Ecotropic viral integration site 2B
• Gene symbol: EVI2B
• Synonyms (NCBI Gene): CD361, D17S376, EVDB
• Chromosome: 17
• Chromosome location: 17q11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021569	hsa-miR-142-3p	Microarray	17612493
MIRT972191	hsa-let-7a	CLIP-seq
MIRT972192	hsa-let-7b	CLIP-seq
MIRT972193	hsa-let-7c	CLIP-seq
MIRT972194	hsa-let-7d	CLIP-seq
MIRT972195	hsa-let-7e	CLIP-seq
MIRT972196	hsa-let-7f	CLIP-seq
MIRT972197	hsa-let-7g	CLIP-seq
MIRT972198	hsa-let-7i	CLIP-seq
MIRT972199	hsa-miR-202	CLIP-seq
MIRT972200	hsa-miR-4458	CLIP-seq
MIRT972201	hsa-miR-4500	CLIP-seq
MIRT972202	hsa-miR-4678	CLIP-seq
MIRT972203	hsa-miR-4775	CLIP-seq
MIRT972204	hsa-miR-548a-3p	CLIP-seq
MIRT972205	hsa-miR-548e	CLIP-seq
MIRT972206	hsa-miR-548f	CLIP-seq
MIRT972207	hsa-miR-98	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	TAS	1903357
GO:0016020	Component	Membrane	IEA
GO:0030854	Process	Positive regulation of granulocyte differentiation	IEA
GO:0030854	Process	Positive regulation of granulocyte differentiation	IMP	28186500
GO:0030854	Process	Positive regulation of granulocyte differentiation	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0045660	Process	Positive regulation of neutrophil differentiation	IBA
GO:0045660	Process	Positive regulation of neutrophil differentiation	IEA
GO:0045660	Process	Positive regulation of neutrophil differentiation	ISS
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0061515	Process	Myeloid cell development	IEA
GO:0061515	Process	Myeloid cell development	ISS
GO:2000035	Process	Regulation of stem cell division	IBA
GO:2000035	Process	Regulation of stem cell division	IEA
GO:2000035	Process	Regulation of stem cell division	ISS

Other IDs

• MIM: 158381
• HGNC: 3500
• e!Ensembl: ENSG00000185862

Protein

• UniProt ID: P34910
• Protein name: Protein EVI2B (Ecotropic viral integration site 2B protein homolog) (EVI-2B) (CD antigen CD361)
• Protein function: Required for granulocyte differentiation and functionality of hematopoietic progenitor cells through the control of cell cycle progression and survival of hematopoietic progenitor cells.
• Tissue specificity: TISSUE SPECIFICITY: Bone marrow, peripheral blood mononuclear cells, fibroblasts and Epstein-Barr virus-transformed lymphoblastoid cell lines. Strongly expressed in granulocytic cells, and weakly on lymphocytes cells. {ECO:0000269|PubMed:28186500}.
• Sequence:

  MDPKYFILILFCGHLNNTFFSKTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPT
  QFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQA
  VFTSARQLPSARTSTTQPPKSFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRS
  TPGFILDTTSNKQTPQKNNYNSIAAILIGVLLTSMLVAIIIIVLWKCLRKPVLNDQNWAG
  RSPFADGETPDICMDNIRENEISTKRTSIISLTPWKPSKSTLLADDLEIKLFESSENIED
  SNNPKTEKIKDQVNGTSEDSADGSTVGTAVSSSDDADLPPPPPLLDLEGQESNQSDKPTM
  TIVSPLPNDSTSLPPSLDCLNQDCGDHKSEIIQSFPPLDSLNLPLPPVDFMKNQEDSNLE
  IQCQEFSIPPNSDQDLNESLPPPPAELL

• Sequence length: 448

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	30370249		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	11468690	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39290707	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30370249		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39290707	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35840578	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1903357		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	10360836		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	10360836		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	10360836, 1903357		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37063877	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36511103	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36830696	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37063877	Associate	★☆☆☆☆ Found in Text Mining only