Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2119
Gene name	ETS variant transcription factor 5
Gene symbol	ETV5
Synonyms (NCBI Gene)	ERM
Chromosome	3
Chromosome location	3q27.2

250

Show/Hide all (250)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017311	hsa-miR-335-5p	Microarray	18185580
MIRT530651	hsa-miR-4453	PAR-CLIP	22012620
MIRT530650	hsa-miR-4538	PAR-CLIP	22012620
MIRT530649	hsa-miR-1539	PAR-CLIP	22012620
MIRT530648	hsa-miR-5689	PAR-CLIP	22012620
MIRT530647	hsa-miR-3173-5p	PAR-CLIP	22012620
MIRT530646	hsa-miR-6799-3p	PAR-CLIP	22012620
MIRT530645	hsa-miR-1291	PAR-CLIP	22012620
MIRT530644	hsa-miR-6775-3p	PAR-CLIP	22012620
MIRT530643	hsa-miR-7150	PAR-CLIP	22012620
MIRT530651	hsa-miR-4453	PAR-CLIP	22012620
MIRT530650	hsa-miR-4538	PAR-CLIP	22012620
MIRT530649	hsa-miR-1539	PAR-CLIP	22012620
MIRT530648	hsa-miR-5689	PAR-CLIP	22012620
MIRT530647	hsa-miR-3173-5p	PAR-CLIP	22012620
MIRT530646	hsa-miR-6799-3p	PAR-CLIP	22012620
MIRT530645	hsa-miR-1291	PAR-CLIP	22012620
MIRT530644	hsa-miR-6775-3p	PAR-CLIP	22012620
MIRT530643	hsa-miR-7150	PAR-CLIP	22012620
MIRT756010	hsa-miR-200c-3p	Luciferase reporter assayWestern blottingqRT-PCR	34753799
MIRT971999	hsa-miR-125a-3p	CLIP-seq
MIRT972000	hsa-miR-1292	CLIP-seq
MIRT972001	hsa-miR-19a	CLIP-seq
MIRT972002	hsa-miR-19b	CLIP-seq
MIRT972003	hsa-miR-3140-5p	CLIP-seq
MIRT972004	hsa-miR-330-3p	CLIP-seq
MIRT972005	hsa-miR-3934	CLIP-seq
MIRT972006	hsa-miR-4471	CLIP-seq
MIRT972007	hsa-miR-4690-5p	CLIP-seq
MIRT972008	hsa-miR-4742-5p	CLIP-seq
MIRT972009	hsa-miR-4790-3p	CLIP-seq
MIRT972010	hsa-miR-510	CLIP-seq
MIRT972011	hsa-miR-621	CLIP-seq
MIRT972012	hsa-miR-764	CLIP-seq
MIRT1987968	hsa-miR-146b-3p	CLIP-seq
MIRT1987969	hsa-miR-200b	CLIP-seq
MIRT1987970	hsa-miR-200c	CLIP-seq
MIRT1987971	hsa-miR-369-3p	CLIP-seq
MIRT1987972	hsa-miR-3925-3p	CLIP-seq
MIRT1987973	hsa-miR-429	CLIP-seq
MIRT1987974	hsa-miR-515-5p	CLIP-seq
MIRT1987975	hsa-miR-766	CLIP-seq
MIRT1987976	hsa-miR-874	CLIP-seq
MIRT1987977	hsa-miR-888	CLIP-seq
MIRT2222395	hsa-miR-23a	CLIP-seq
MIRT2222396	hsa-miR-23b	CLIP-seq
MIRT2222397	hsa-miR-23c	CLIP-seq
MIRT2387554	hsa-miR-137	CLIP-seq
MIRT2387555	hsa-miR-2115	CLIP-seq
MIRT2387556	hsa-miR-3125	CLIP-seq
MIRT2387557	hsa-miR-3150b-3p	CLIP-seq
MIRT2387558	hsa-miR-323b-3p	CLIP-seq
MIRT2387559	hsa-miR-3916	CLIP-seq
MIRT2387560	hsa-miR-4701-5p	CLIP-seq
MIRT2387561	hsa-miR-4784	CLIP-seq
MIRT2387562	hsa-miR-588	CLIP-seq
MIRT2387563	hsa-miR-877	CLIP-seq
MIRT2435124	hsa-miR-129-5p	CLIP-seq
MIRT2525886	hsa-miR-122	CLIP-seq
MIRT2525887	hsa-miR-1236	CLIP-seq
MIRT2525888	hsa-miR-1284	CLIP-seq
MIRT2525889	hsa-miR-136	CLIP-seq
MIRT2387554	hsa-miR-137	CLIP-seq
MIRT1987968	hsa-miR-146b-3p	CLIP-seq
MIRT2525890	hsa-miR-186	CLIP-seq
MIRT2525891	hsa-miR-198	CLIP-seq
MIRT2525892	hsa-miR-203	CLIP-seq
MIRT2525893	hsa-miR-205	CLIP-seq
MIRT2525894	hsa-miR-2278	CLIP-seq
MIRT2222395	hsa-miR-23a	CLIP-seq
MIRT2222396	hsa-miR-23b	CLIP-seq
MIRT2222397	hsa-miR-23c	CLIP-seq
MIRT2525895	hsa-miR-296-3p	CLIP-seq
MIRT2525896	hsa-miR-3065-3p	CLIP-seq
MIRT2525897	hsa-miR-3120-3p	CLIP-seq
MIRT2525898	hsa-miR-3123	CLIP-seq
MIRT2525899	hsa-miR-3133	CLIP-seq
MIRT2525900	hsa-miR-3160-5p	CLIP-seq
MIRT2525901	hsa-miR-3171	CLIP-seq
MIRT2525902	hsa-miR-3173-3p	CLIP-seq
MIRT2525903	hsa-miR-3180-5p	CLIP-seq
MIRT2387558	hsa-miR-323b-3p	CLIP-seq
MIRT2525904	hsa-miR-323b-5p	CLIP-seq
MIRT2525905	hsa-miR-3606	CLIP-seq
MIRT2525906	hsa-miR-3616-3p	CLIP-seq
MIRT2525907	hsa-miR-3621	CLIP-seq
MIRT2525908	hsa-miR-3656	CLIP-seq
MIRT2525909	hsa-miR-3657	CLIP-seq
MIRT2525910	hsa-miR-3658	CLIP-seq
MIRT2525911	hsa-miR-3672	CLIP-seq
MIRT1987971	hsa-miR-369-3p	CLIP-seq
MIRT2525912	hsa-miR-374a	CLIP-seq
MIRT2525913	hsa-miR-374b	CLIP-seq
MIRT2525914	hsa-miR-374c	CLIP-seq
MIRT2525915	hsa-miR-376c	CLIP-seq
MIRT2525916	hsa-miR-377	CLIP-seq
MIRT2525917	hsa-miR-3908	CLIP-seq
MIRT2525918	hsa-miR-3925-5p	CLIP-seq
MIRT2525919	hsa-miR-3928	CLIP-seq
MIRT2525920	hsa-miR-3936	CLIP-seq
MIRT2525921	hsa-miR-3942-3p	CLIP-seq
MIRT2525922	hsa-miR-3976	CLIP-seq
MIRT2525923	hsa-miR-4253	CLIP-seq
MIRT2525924	hsa-miR-4280	CLIP-seq
MIRT2525925	hsa-miR-4305	CLIP-seq
MIRT2525926	hsa-miR-4313	CLIP-seq
MIRT2525927	hsa-miR-4426	CLIP-seq
MIRT2525928	hsa-miR-4428	CLIP-seq
MIRT2525929	hsa-miR-4449	CLIP-seq
MIRT972006	hsa-miR-4471	CLIP-seq
MIRT2525930	hsa-miR-4502	CLIP-seq
MIRT2525931	hsa-miR-450a	CLIP-seq
MIRT2525932	hsa-miR-4514	CLIP-seq
MIRT2525933	hsa-miR-4530	CLIP-seq
MIRT2525934	hsa-miR-4637	CLIP-seq
MIRT2525935	hsa-miR-4643	CLIP-seq
MIRT2525936	hsa-miR-4645-5p	CLIP-seq
MIRT2525937	hsa-miR-4647	CLIP-seq
MIRT2525938	hsa-miR-4662b	CLIP-seq
MIRT2525939	hsa-miR-4669	CLIP-seq
MIRT2525940	hsa-miR-4673	CLIP-seq
MIRT972007	hsa-miR-4690-5p	CLIP-seq
MIRT2525941	hsa-miR-4692	CLIP-seq
MIRT2525942	hsa-miR-4695-3p	CLIP-seq
MIRT2525943	hsa-miR-4761-3p	CLIP-seq
MIRT2525944	hsa-miR-4777-5p	CLIP-seq
MIRT2525945	hsa-miR-4798-3p	CLIP-seq
MIRT2525946	hsa-miR-4802-5p	CLIP-seq
MIRT2525947	hsa-miR-490-3p	CLIP-seq
MIRT2525948	hsa-miR-495	CLIP-seq
MIRT2525949	hsa-miR-518d-5p	CLIP-seq
MIRT2525950	hsa-miR-519b-5p	CLIP-seq
MIRT2525951	hsa-miR-519c-5p	CLIP-seq
MIRT2525952	hsa-miR-520a-5p	CLIP-seq
MIRT2525953	hsa-miR-520c-5p	CLIP-seq
MIRT2525954	hsa-miR-525-5p	CLIP-seq
MIRT2525955	hsa-miR-526a	CLIP-seq
MIRT2525956	hsa-miR-548a-3p	CLIP-seq
MIRT2525957	hsa-miR-548e	CLIP-seq
MIRT2525958	hsa-miR-548f	CLIP-seq
MIRT2525959	hsa-miR-570	CLIP-seq
MIRT2525960	hsa-miR-580	CLIP-seq
MIRT2525961	hsa-miR-581	CLIP-seq
MIRT2525962	hsa-miR-592	CLIP-seq
MIRT2525963	hsa-miR-595	CLIP-seq
MIRT2525964	hsa-miR-597	CLIP-seq
MIRT2525965	hsa-miR-599	CLIP-seq
MIRT2525966	hsa-miR-602	CLIP-seq
MIRT2525967	hsa-miR-629	CLIP-seq
MIRT2525968	hsa-miR-634	CLIP-seq
MIRT2525969	hsa-miR-642b	CLIP-seq
MIRT2525970	hsa-miR-649	CLIP-seq
MIRT2525971	hsa-miR-655	CLIP-seq
MIRT1987976	hsa-miR-874	CLIP-seq
MIRT2525972	hsa-miR-921	CLIP-seq
MIRT2525973	hsa-miR-922	CLIP-seq
MIRT2525974	hsa-miR-939	CLIP-seq
MIRT2525886	hsa-miR-122	CLIP-seq
MIRT2525887	hsa-miR-1236	CLIP-seq
MIRT2680358	hsa-miR-1238	CLIP-seq
MIRT2525888	hsa-miR-1284	CLIP-seq
MIRT2525889	hsa-miR-136	CLIP-seq
MIRT2387554	hsa-miR-137	CLIP-seq
MIRT1987968	hsa-miR-146b-3p	CLIP-seq
MIRT2525890	hsa-miR-186	CLIP-seq
MIRT2680359	hsa-miR-1915	CLIP-seq
MIRT2525891	hsa-miR-198	CLIP-seq
MIRT2525892	hsa-miR-203	CLIP-seq
MIRT2525893	hsa-miR-205	CLIP-seq
MIRT2525894	hsa-miR-2278	CLIP-seq
MIRT2222395	hsa-miR-23a	CLIP-seq
MIRT2222396	hsa-miR-23b	CLIP-seq
MIRT2222397	hsa-miR-23c	CLIP-seq
MIRT2525895	hsa-miR-296-3p	CLIP-seq
MIRT2525896	hsa-miR-3065-3p	CLIP-seq
MIRT2525898	hsa-miR-3123	CLIP-seq
MIRT2525899	hsa-miR-3133	CLIP-seq
MIRT2525900	hsa-miR-3160-5p	CLIP-seq
MIRT2525901	hsa-miR-3171	CLIP-seq
MIRT2525902	hsa-miR-3173-3p	CLIP-seq
MIRT2525903	hsa-miR-3180-5p	CLIP-seq
MIRT2525905	hsa-miR-3606	CLIP-seq
MIRT2680360	hsa-miR-3613-3p	CLIP-seq
MIRT2525906	hsa-miR-3616-3p	CLIP-seq
MIRT2525907	hsa-miR-3621	CLIP-seq
MIRT2525908	hsa-miR-3656	CLIP-seq
MIRT2525909	hsa-miR-3657	CLIP-seq
MIRT2525910	hsa-miR-3658	CLIP-seq
MIRT2525911	hsa-miR-3672	CLIP-seq
MIRT2680361	hsa-miR-3688-3p	CLIP-seq
MIRT2525915	hsa-miR-376c	CLIP-seq
MIRT2525916	hsa-miR-377	CLIP-seq
MIRT2525918	hsa-miR-3925-5p	CLIP-seq
MIRT2525919	hsa-miR-3928	CLIP-seq
MIRT2525920	hsa-miR-3936	CLIP-seq
MIRT2525921	hsa-miR-3942-3p	CLIP-seq
MIRT2525922	hsa-miR-3976	CLIP-seq
MIRT2525923	hsa-miR-4253	CLIP-seq
MIRT2525924	hsa-miR-4280	CLIP-seq
MIRT2525925	hsa-miR-4305	CLIP-seq
MIRT2525926	hsa-miR-4313	CLIP-seq
MIRT2525927	hsa-miR-4426	CLIP-seq
MIRT2525928	hsa-miR-4428	CLIP-seq
MIRT2525929	hsa-miR-4449	CLIP-seq
MIRT972006	hsa-miR-4471	CLIP-seq
MIRT2525930	hsa-miR-4502	CLIP-seq
MIRT2525931	hsa-miR-450a	CLIP-seq
MIRT2525932	hsa-miR-4514	CLIP-seq
MIRT2525933	hsa-miR-4530	CLIP-seq
MIRT2525934	hsa-miR-4637	CLIP-seq
MIRT2525935	hsa-miR-4643	CLIP-seq
MIRT2525936	hsa-miR-4645-5p	CLIP-seq
MIRT2525937	hsa-miR-4647	CLIP-seq
MIRT2525938	hsa-miR-4662b	CLIP-seq
MIRT2525939	hsa-miR-4669	CLIP-seq
MIRT2525940	hsa-miR-4673	CLIP-seq
MIRT972007	hsa-miR-4690-5p	CLIP-seq
MIRT2525941	hsa-miR-4692	CLIP-seq
MIRT2680362	hsa-miR-4694-3p	CLIP-seq
MIRT2525942	hsa-miR-4695-3p	CLIP-seq
MIRT2680363	hsa-miR-4704-3p	CLIP-seq
MIRT2680364	hsa-miR-4733-5p	CLIP-seq
MIRT2525943	hsa-miR-4761-3p	CLIP-seq
MIRT2525944	hsa-miR-4777-5p	CLIP-seq
MIRT2525945	hsa-miR-4798-3p	CLIP-seq
MIRT2525946	hsa-miR-4802-5p	CLIP-seq
MIRT2525947	hsa-miR-490-3p	CLIP-seq
MIRT2525948	hsa-miR-495	CLIP-seq
MIRT2525949	hsa-miR-518d-5p	CLIP-seq
MIRT2525950	hsa-miR-519b-5p	CLIP-seq
MIRT2525951	hsa-miR-519c-5p	CLIP-seq
MIRT2525952	hsa-miR-520a-5p	CLIP-seq
MIRT2525953	hsa-miR-520c-5p	CLIP-seq
MIRT2525954	hsa-miR-525-5p	CLIP-seq
MIRT2525955	hsa-miR-526a	CLIP-seq
MIRT2525959	hsa-miR-570	CLIP-seq
MIRT2525961	hsa-miR-581	CLIP-seq
MIRT2525962	hsa-miR-592	CLIP-seq
MIRT2525963	hsa-miR-595	CLIP-seq
MIRT2525964	hsa-miR-597	CLIP-seq
MIRT2525965	hsa-miR-599	CLIP-seq
MIRT2525966	hsa-miR-602	CLIP-seq
MIRT2525967	hsa-miR-629	CLIP-seq
MIRT2525968	hsa-miR-634	CLIP-seq
MIRT2525969	hsa-miR-642b	CLIP-seq
MIRT2525970	hsa-miR-649	CLIP-seq
MIRT1987976	hsa-miR-874	CLIP-seq
MIRT2525972	hsa-miR-921	CLIP-seq
MIRT2525973	hsa-miR-922	CLIP-seq
MIRT2525974	hsa-miR-939	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17126306
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	19443906
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	15857832
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	15857832
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	8152800
GO:0003700	Function	DNA-binding transcription factor activity	IDA	19443906
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8152800
GO:0005515	Function	Protein binding	IPI	17126306, 33961781, 35140242
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19443906
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007274	Process	Neuromuscular synaptic transmission	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0034599	Process	Cellular response to oxidative stress	IDA	19443906
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	15857832
GO:0048133	Process	Male germ-line stem cell asymmetric division	IEA
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0060762	Process	Regulation of branching involved in mammary gland duct morphogenesis	IEA
GO:0071340	Process	Skeletal muscle acetylcholine-gated channel clustering	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
601600	3494	ENSG00000244405

P41161

Protein name

ETS translocation variant 5 (Ets-related protein ERM)

Protein function

Binds to DNA sequences containing the consensus nucleotide core sequence 5'-GGAA.-3'.

PDB

4UNO , 5ILV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04621	ETS_PEA3_N	1 → 366	PEA3 subfamily ETS-domain transcription factor N terminal domain	Family
PF00178	Ets	369 → 448	Ets-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNY
CAYDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHS
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNR
PSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYC
VDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGP
PYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD
KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDT
LPLTHFEDSPAYLLDMDRCSSLPYAEGFAY

Sequence length

510

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer Prostate cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Myoepithelial tumor	Pathogenic	rs772183700	RCV002463939	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ETV5-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (101)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	29532564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11092524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	24756106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrioventricular Septal Defect	Atrioventricular septal defect	BEFREE	31322043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24117813, 28855737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	22771031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	22771031		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12036888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	27280443, 31754094		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	31754094	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30952872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29787563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15534105, 22570330, 28624994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34224831, 35317849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24756106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19465903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	24756106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	31162284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30952872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	9892180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22589409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	19443906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21520040, 22589409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	30291136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	22968857, 25145279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	22968857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18779747, 29496177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30650178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35860243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	28233365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25801911		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	16175655, 19443906, 24756106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16175655, 19443906, 22266854, 22911547, 25233929, 25261936, 25924802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	17638886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	28195624, 30025106, 30309772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21520040, 22589409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35813298	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	24723486, 27783944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Full thickness hole of macula lutea	Full Thickness Hole Of Macula Lutea	BEFREE	28195624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	28233365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28645872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	GWASCAT_DG	29124443		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune System Diseases	BEFREE	28287407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	22771031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31628427		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21135260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	27790742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	9892180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30650178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29496177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	30693103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	30693103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	12356905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15534105, 22570330, 28624994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19443906, 22911547, 25233929, 25261936, 25924802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	9892180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22589409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28602912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18172298, 18794152, 21572435, 22425584, 23578236, 25203299, 28408625, 30204534, 31016435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	27783944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30952872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12036888, 15121044, 19432821, 22968857, 24117813, 26209696, 29307852, 31186776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15534105		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21087211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21087211, 32413516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15534105, 16175655, 19443906, 20553997, 22266854, 23666797, 24756106, 25801911, 25924802, 29321660, 29626191, 29787563, 30224826, 30425164, 30650178, 9892180 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	9403715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29321660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	29787563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	12356905, 27958595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	19851340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20520848, 23349760, 23539184, 23950976, 27421018, 31754094	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	21796137, 24710089, 27280443, 28041791, 28645872, 31754094		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	GWASDB_DG	23563607		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	GWASCAT_DG	23563607		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	24924175		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22589409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22589409, 34736492, 34887384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28602912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29532564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30250553, 30265861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	29787563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	26073130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23326330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	19386269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	30025106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18172298, 21572435, 22425584, 23578236, 25203299, 28408625, 30204534, 31016435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18172298		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18794152, 20693979, 20975660, 25203299, 25544710	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	22425584		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	27783944		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	15716351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Radial polydactyly	Radial Polydactyly	BEFREE	19386269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Regular astigmatism - corneal	Corneal astigmatism	BEFREE	30309772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25406076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	30291136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	27790742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	27790742, 36153506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schwannomatosis	Schwannomatosis	BEFREE	27958595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30265861	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TUMOR PREDISPOSITION SYNDROME	TUMOR PREDISPOSITION SYNDROME	BEFREE	12356905		★★★★★ ★☆☆☆☆ Found in Text Mining only

ETV5 (ETS variant transcription factor 5)