Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2115
Gene name	ETS variant transcription factor 1
Gene symbol	ETV1
Synonyms (NCBI Gene)	ER81
Chromosome	7
Chromosome location	7p21.2
Summary	This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS prot

331

Show/Hide all (331)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017630	hsa-miR-335-5p	Microarray	18185580
MIRT438055	hsa-miR-17-5p	Luciferase reporter assayqRT-PCRmicroarrayWestern blotting	23969726
MIRT438054	hsa-miR-20a-5p	Luciferase reporter assayqRT-PCRmicroarrayWestern blotting	23969726
MIRT438055	hsa-miR-17-5p	Luciferase reporter assayqRT-PCRmicroarrayWestern blotting	23969726
MIRT438054	hsa-miR-20a-5p	Luciferase reporter assayqRT-PCRmicroarrayWestern blotting	23969726
MIRT438055	hsa-miR-17-5p	qRT-PCRWestern blot	26158900
MIRT733449	hsa-miR-200b-3p	Luciferase reporter assayqRT-PCRWestern blotting	32708220
MIRT733521	hsa-miR-628-5p	MicroarrayqRT-PCRWestern blotting	34152611
MIRT733521	hsa-miR-628-5p	qRT-PCRWestern blotting	32797637
MIRT734398	hsa-miR-383-3p	qRT-PCRWestern blotting	32797637
MIRT735656	hsa-miR-101-3p	Western blottingMicroarrayqRT-PCR	31970478
MIRT971932	hsa-miR-129-5p	CLIP-seq
MIRT971933	hsa-miR-3140-3p	CLIP-seq
MIRT971934	hsa-miR-4311	CLIP-seq
MIRT971935	hsa-miR-4428	CLIP-seq
MIRT971936	hsa-miR-101	CLIP-seq
MIRT971937	hsa-miR-1279	CLIP-seq
MIRT971938	hsa-miR-144	CLIP-seq
MIRT971939	hsa-miR-197	CLIP-seq
MIRT971940	hsa-miR-205	CLIP-seq
MIRT971941	hsa-miR-216a	CLIP-seq
MIRT971942	hsa-miR-3120-3p	CLIP-seq
MIRT971943	hsa-miR-3137	CLIP-seq
MIRT971944	hsa-miR-3150a-3p	CLIP-seq
MIRT971945	hsa-miR-3175	CLIP-seq
MIRT971946	hsa-miR-3646	CLIP-seq
MIRT971947	hsa-miR-3662	CLIP-seq
MIRT971948	hsa-miR-4279	CLIP-seq
MIRT971949	hsa-miR-455-3p	CLIP-seq
MIRT971950	hsa-miR-4701-5p	CLIP-seq
MIRT971951	hsa-miR-4703-3p	CLIP-seq
MIRT971952	hsa-miR-4727-3p	CLIP-seq
MIRT971953	hsa-miR-4762-5p	CLIP-seq
MIRT971954	hsa-miR-4769-3p	CLIP-seq
MIRT971955	hsa-miR-4775	CLIP-seq
MIRT971956	hsa-miR-4789-5p	CLIP-seq
MIRT971957	hsa-miR-4793-3p	CLIP-seq
MIRT971958	hsa-miR-485-3p	CLIP-seq
MIRT971959	hsa-miR-491-5p	CLIP-seq
MIRT971960	hsa-miR-5096	CLIP-seq
MIRT971961	hsa-miR-539	CLIP-seq
MIRT971962	hsa-miR-544	CLIP-seq
MIRT971963	hsa-miR-548g	CLIP-seq
MIRT971964	hsa-miR-580	CLIP-seq
MIRT971965	hsa-miR-582-5p	CLIP-seq
MIRT971966	hsa-miR-587	CLIP-seq
MIRT971967	hsa-miR-588	CLIP-seq
MIRT971968	hsa-miR-590-3p	CLIP-seq
MIRT971969	hsa-miR-891b	CLIP-seq
MIRT971970	hsa-miR-936	CLIP-seq
MIRT971971	hsa-miR-939	CLIP-seq
MIRT971942	hsa-miR-3120-3p	CLIP-seq
MIRT1987954	hsa-miR-3145-3p	CLIP-seq
MIRT1987955	hsa-miR-3161	CLIP-seq
MIRT1987956	hsa-miR-4731-3p	CLIP-seq
MIRT1987957	hsa-miR-4801	CLIP-seq
MIRT1987958	hsa-miR-515-5p	CLIP-seq
MIRT1987959	hsa-miR-579	CLIP-seq
MIRT2222367	hsa-miR-1236	CLIP-seq
MIRT2222368	hsa-miR-1238	CLIP-seq
MIRT2222369	hsa-miR-136	CLIP-seq
MIRT2222370	hsa-miR-3183	CLIP-seq
MIRT2222371	hsa-miR-3692	CLIP-seq
MIRT2222372	hsa-miR-4291	CLIP-seq
MIRT971934	hsa-miR-4311	CLIP-seq
MIRT2222373	hsa-miR-4723-3p	CLIP-seq
MIRT1987958	hsa-miR-515-5p	CLIP-seq
MIRT971962	hsa-miR-544	CLIP-seq
MIRT2222374	hsa-miR-922	CLIP-seq
MIRT2222375	hsa-miR-942	CLIP-seq
MIRT2442144	hsa-miR-4738-3p	CLIP-seq
MIRT2442145	hsa-miR-556-3p	CLIP-seq
MIRT2448971	hsa-miR-127-5p	CLIP-seq
MIRT2448972	hsa-miR-550b	CLIP-seq
MIRT1987959	hsa-miR-579	CLIP-seq
MIRT2525771	hsa-miR-105	CLIP-seq
MIRT2525772	hsa-miR-106a	CLIP-seq
MIRT2525773	hsa-miR-106b	CLIP-seq
MIRT2525774	hsa-miR-10a	CLIP-seq
MIRT2525775	hsa-miR-10b	CLIP-seq
MIRT2525776	hsa-miR-1224-3p	CLIP-seq
MIRT2525777	hsa-miR-124	CLIP-seq
MIRT2525778	hsa-miR-1260	CLIP-seq
MIRT2525779	hsa-miR-1260b	CLIP-seq
MIRT2525780	hsa-miR-1280	CLIP-seq
MIRT2525781	hsa-miR-1298	CLIP-seq
MIRT2525782	hsa-miR-1323	CLIP-seq
MIRT2525783	hsa-miR-142-5p	CLIP-seq
MIRT2525784	hsa-miR-17	CLIP-seq
MIRT2525785	hsa-miR-1913	CLIP-seq
MIRT971939	hsa-miR-197	CLIP-seq
MIRT2525786	hsa-miR-203	CLIP-seq
MIRT971940	hsa-miR-205	CLIP-seq
MIRT2525787	hsa-miR-20a	CLIP-seq
MIRT2525788	hsa-miR-20b	CLIP-seq
MIRT2525789	hsa-miR-2113	CLIP-seq
MIRT971941	hsa-miR-216a	CLIP-seq
MIRT2525790	hsa-miR-23a	CLIP-seq
MIRT2525791	hsa-miR-23b	CLIP-seq
MIRT2525792	hsa-miR-23c	CLIP-seq
MIRT2525793	hsa-miR-302a	CLIP-seq
MIRT2525794	hsa-miR-302b	CLIP-seq
MIRT2525795	hsa-miR-302c	CLIP-seq
MIRT2525796	hsa-miR-302d	CLIP-seq
MIRT2525797	hsa-miR-302e	CLIP-seq
MIRT2525798	hsa-miR-3143	CLIP-seq
MIRT971944	hsa-miR-3150a-3p	CLIP-seq
MIRT2525799	hsa-miR-3160-5p	CLIP-seq
MIRT2525800	hsa-miR-3163	CLIP-seq
MIRT2525801	hsa-miR-3171	CLIP-seq
MIRT971945	hsa-miR-3175	CLIP-seq
MIRT2525802	hsa-miR-324-3p	CLIP-seq
MIRT2525803	hsa-miR-330-3p	CLIP-seq
MIRT2525804	hsa-miR-3609	CLIP-seq
MIRT2525805	hsa-miR-3613-3p	CLIP-seq
MIRT971946	hsa-miR-3646	CLIP-seq
MIRT971947	hsa-miR-3662	CLIP-seq
MIRT2525806	hsa-miR-3671	CLIP-seq
MIRT2525807	hsa-miR-3714	CLIP-seq
MIRT2525808	hsa-miR-371b-5p	CLIP-seq
MIRT2525809	hsa-miR-372	CLIP-seq
MIRT2525810	hsa-miR-373	CLIP-seq
MIRT2525811	hsa-miR-3910	CLIP-seq
MIRT2525812	hsa-miR-3920	CLIP-seq
MIRT2525813	hsa-miR-3935	CLIP-seq
MIRT2525814	hsa-miR-4263	CLIP-seq
MIRT2525815	hsa-miR-4275	CLIP-seq
MIRT971934	hsa-miR-4311	CLIP-seq
MIRT2525816	hsa-miR-4328	CLIP-seq
MIRT2525817	hsa-miR-4420	CLIP-seq
MIRT2525818	hsa-miR-4427	CLIP-seq
MIRT971935	hsa-miR-4428	CLIP-seq
MIRT2525819	hsa-miR-4477b	CLIP-seq
MIRT2525820	hsa-miR-4484	CLIP-seq
MIRT2525821	hsa-miR-4509	CLIP-seq
MIRT971949	hsa-miR-455-3p	CLIP-seq
MIRT2525822	hsa-miR-4641	CLIP-seq
MIRT2525823	hsa-miR-4698	CLIP-seq
MIRT971950	hsa-miR-4701-5p	CLIP-seq
MIRT2525824	hsa-miR-4705	CLIP-seq
MIRT2525825	hsa-miR-4718	CLIP-seq
MIRT971952	hsa-miR-4727-3p	CLIP-seq
MIRT2525826	hsa-miR-4733-5p	CLIP-seq
MIRT2442144	hsa-miR-4738-3p	CLIP-seq
MIRT2525827	hsa-miR-4744	CLIP-seq
MIRT2525828	hsa-miR-4762-3p	CLIP-seq
MIRT971953	hsa-miR-4762-5p	CLIP-seq
MIRT2525829	hsa-miR-4778-3p	CLIP-seq
MIRT2525830	hsa-miR-4795-3p	CLIP-seq
MIRT2525831	hsa-miR-4796-3p	CLIP-seq
MIRT2525832	hsa-miR-487a	CLIP-seq
MIRT971959	hsa-miR-491-5p	CLIP-seq
MIRT2525833	hsa-miR-494	CLIP-seq
MIRT2525834	hsa-miR-506	CLIP-seq
MIRT971960	hsa-miR-5096	CLIP-seq
MIRT2525835	hsa-miR-512-3p	CLIP-seq
MIRT1987958	hsa-miR-515-5p	CLIP-seq
MIRT2525836	hsa-miR-518a-5p	CLIP-seq
MIRT2525837	hsa-miR-519a	CLIP-seq
MIRT2525838	hsa-miR-519b-3p	CLIP-seq
MIRT2525839	hsa-miR-519c-3p	CLIP-seq
MIRT2525840	hsa-miR-519d	CLIP-seq
MIRT2525841	hsa-miR-520a-3p	CLIP-seq
MIRT2525842	hsa-miR-520b	CLIP-seq
MIRT2525843	hsa-miR-520c-3p	CLIP-seq
MIRT2525844	hsa-miR-520d-3p	CLIP-seq
MIRT2525845	hsa-miR-520e	CLIP-seq
MIRT2525846	hsa-miR-527	CLIP-seq
MIRT2525847	hsa-miR-548a-3p	CLIP-seq
MIRT2525848	hsa-miR-548a-5p	CLIP-seq
MIRT2525849	hsa-miR-548ab	CLIP-seq
MIRT2525850	hsa-miR-548ae	CLIP-seq
MIRT2525851	hsa-miR-548ah	CLIP-seq
MIRT2525852	hsa-miR-548aj	CLIP-seq
MIRT2525853	hsa-miR-548ak	CLIP-seq
MIRT2525854	hsa-miR-548am	CLIP-seq
MIRT2525855	hsa-miR-548an	CLIP-seq
MIRT2525856	hsa-miR-548b-5p	CLIP-seq
MIRT2525857	hsa-miR-548c-3p	CLIP-seq
MIRT2525858	hsa-miR-548c-5p	CLIP-seq
MIRT2525859	hsa-miR-548d-5p	CLIP-seq
MIRT2525860	hsa-miR-548e	CLIP-seq
MIRT2525861	hsa-miR-548f	CLIP-seq
MIRT2525862	hsa-miR-548h	CLIP-seq
MIRT2525863	hsa-miR-548i	CLIP-seq
MIRT2525864	hsa-miR-548j	CLIP-seq
MIRT2525865	hsa-miR-548n	CLIP-seq
MIRT2525866	hsa-miR-548o	CLIP-seq
MIRT2525867	hsa-miR-548p	CLIP-seq
MIRT2525868	hsa-miR-548w	CLIP-seq
MIRT2525869	hsa-miR-548x	CLIP-seq
MIRT2525870	hsa-miR-548y	CLIP-seq
MIRT2525871	hsa-miR-559	CLIP-seq
MIRT971965	hsa-miR-582-5p	CLIP-seq
MIRT971967	hsa-miR-588	CLIP-seq
MIRT2525872	hsa-miR-599	CLIP-seq
MIRT2525873	hsa-miR-605	CLIP-seq
MIRT2525874	hsa-miR-607	CLIP-seq
MIRT2525875	hsa-miR-642a	CLIP-seq
MIRT2525876	hsa-miR-888	CLIP-seq
MIRT2525877	hsa-miR-93	CLIP-seq
MIRT971971	hsa-miR-939	CLIP-seq
MIRT2525771	hsa-miR-105	CLIP-seq
MIRT2525772	hsa-miR-106a	CLIP-seq
MIRT2525773	hsa-miR-106b	CLIP-seq
MIRT2525774	hsa-miR-10a	CLIP-seq
MIRT2525775	hsa-miR-10b	CLIP-seq
MIRT2525776	hsa-miR-1224-3p	CLIP-seq
MIRT2525778	hsa-miR-1260	CLIP-seq
MIRT2525779	hsa-miR-1260b	CLIP-seq
MIRT2525780	hsa-miR-1280	CLIP-seq
MIRT2525781	hsa-miR-1298	CLIP-seq
MIRT2525782	hsa-miR-1323	CLIP-seq
MIRT2525783	hsa-miR-142-5p	CLIP-seq
MIRT2525784	hsa-miR-17	CLIP-seq
MIRT2525786	hsa-miR-203	CLIP-seq
MIRT2525787	hsa-miR-20a	CLIP-seq
MIRT2525788	hsa-miR-20b	CLIP-seq
MIRT2525789	hsa-miR-2113	CLIP-seq
MIRT2525793	hsa-miR-302a	CLIP-seq
MIRT2525794	hsa-miR-302b	CLIP-seq
MIRT2525795	hsa-miR-302c	CLIP-seq
MIRT2525796	hsa-miR-302d	CLIP-seq
MIRT2525797	hsa-miR-302e	CLIP-seq
MIRT2680339	hsa-miR-3136-3p	CLIP-seq
MIRT2525798	hsa-miR-3143	CLIP-seq
MIRT1987954	hsa-miR-3145-3p	CLIP-seq
MIRT971944	hsa-miR-3150a-3p	CLIP-seq
MIRT2525799	hsa-miR-3160-5p	CLIP-seq
MIRT2525800	hsa-miR-3163	CLIP-seq
MIRT971945	hsa-miR-3175	CLIP-seq
MIRT2680340	hsa-miR-3198	CLIP-seq
MIRT2680341	hsa-miR-3201	CLIP-seq
MIRT2525803	hsa-miR-330-3p	CLIP-seq
MIRT2525804	hsa-miR-3609	CLIP-seq
MIRT2525805	hsa-miR-3613-3p	CLIP-seq
MIRT971946	hsa-miR-3646	CLIP-seq
MIRT2680342	hsa-miR-365	CLIP-seq
MIRT971947	hsa-miR-3662	CLIP-seq
MIRT2525806	hsa-miR-3671	CLIP-seq
MIRT2680343	hsa-miR-3681	CLIP-seq
MIRT2680344	hsa-miR-3691-3p	CLIP-seq
MIRT2680345	hsa-miR-369-3p	CLIP-seq
MIRT2525808	hsa-miR-371b-5p	CLIP-seq
MIRT2525809	hsa-miR-372	CLIP-seq
MIRT2525810	hsa-miR-373	CLIP-seq
MIRT2680346	hsa-miR-374c	CLIP-seq
MIRT2525812	hsa-miR-3920	CLIP-seq
MIRT2680347	hsa-miR-3926	CLIP-seq
MIRT2525813	hsa-miR-3935	CLIP-seq
MIRT2525814	hsa-miR-4263	CLIP-seq
MIRT2680348	hsa-miR-4309	CLIP-seq
MIRT971934	hsa-miR-4311	CLIP-seq
MIRT2525816	hsa-miR-4328	CLIP-seq
MIRT2525817	hsa-miR-4420	CLIP-seq
MIRT2525818	hsa-miR-4427	CLIP-seq
MIRT971935	hsa-miR-4428	CLIP-seq
MIRT2680349	hsa-miR-4474-5p	CLIP-seq
MIRT2525820	hsa-miR-4484	CLIP-seq
MIRT2525821	hsa-miR-4509	CLIP-seq
MIRT971949	hsa-miR-455-3p	CLIP-seq
MIRT2680350	hsa-miR-4640-5p	CLIP-seq
MIRT2680351	hsa-miR-4668-5p	CLIP-seq
MIRT2525823	hsa-miR-4698	CLIP-seq
MIRT971950	hsa-miR-4701-5p	CLIP-seq
MIRT2525824	hsa-miR-4705	CLIP-seq
MIRT2525825	hsa-miR-4718	CLIP-seq
MIRT2680352	hsa-miR-4726-5p	CLIP-seq
MIRT971952	hsa-miR-4727-3p	CLIP-seq
MIRT2680353	hsa-miR-4729	CLIP-seq
MIRT2525826	hsa-miR-4733-5p	CLIP-seq
MIRT2442144	hsa-miR-4738-3p	CLIP-seq
MIRT2525827	hsa-miR-4744	CLIP-seq
MIRT2680354	hsa-miR-4749-3p	CLIP-seq
MIRT2525828	hsa-miR-4762-3p	CLIP-seq
MIRT2525829	hsa-miR-4778-3p	CLIP-seq
MIRT2680355	hsa-miR-4791	CLIP-seq
MIRT2525830	hsa-miR-4795-3p	CLIP-seq
MIRT2525831	hsa-miR-4796-3p	CLIP-seq
MIRT2525832	hsa-miR-487a	CLIP-seq
MIRT971959	hsa-miR-491-5p	CLIP-seq
MIRT2525833	hsa-miR-494	CLIP-seq
MIRT2525835	hsa-miR-512-3p	CLIP-seq
MIRT1987958	hsa-miR-515-5p	CLIP-seq
MIRT2525836	hsa-miR-518a-5p	CLIP-seq
MIRT2525837	hsa-miR-519a	CLIP-seq
MIRT2525838	hsa-miR-519b-3p	CLIP-seq
MIRT2525839	hsa-miR-519c-3p	CLIP-seq
MIRT2525840	hsa-miR-519d	CLIP-seq
MIRT2525841	hsa-miR-520a-3p	CLIP-seq
MIRT2525842	hsa-miR-520b	CLIP-seq
MIRT2525843	hsa-miR-520c-3p	CLIP-seq
MIRT2525844	hsa-miR-520d-3p	CLIP-seq
MIRT2525845	hsa-miR-520e	CLIP-seq
MIRT2525846	hsa-miR-527	CLIP-seq
MIRT2525847	hsa-miR-548a-3p	CLIP-seq
MIRT2525848	hsa-miR-548a-5p	CLIP-seq
MIRT2525849	hsa-miR-548ab	CLIP-seq
MIRT2525850	hsa-miR-548ae	CLIP-seq
MIRT2525851	hsa-miR-548ah	CLIP-seq
MIRT2525852	hsa-miR-548aj	CLIP-seq
MIRT2525853	hsa-miR-548ak	CLIP-seq
MIRT2525854	hsa-miR-548am	CLIP-seq
MIRT2525855	hsa-miR-548an	CLIP-seq
MIRT2525856	hsa-miR-548b-5p	CLIP-seq
MIRT2525857	hsa-miR-548c-3p	CLIP-seq
MIRT2525858	hsa-miR-548c-5p	CLIP-seq
MIRT2525859	hsa-miR-548d-5p	CLIP-seq
MIRT2525860	hsa-miR-548e	CLIP-seq
MIRT2525861	hsa-miR-548f	CLIP-seq
MIRT2525862	hsa-miR-548h	CLIP-seq
MIRT2525863	hsa-miR-548i	CLIP-seq
MIRT2525864	hsa-miR-548j	CLIP-seq
MIRT2525865	hsa-miR-548n	CLIP-seq
MIRT2525866	hsa-miR-548o	CLIP-seq
MIRT2525867	hsa-miR-548p	CLIP-seq
MIRT2525868	hsa-miR-548w	CLIP-seq
MIRT2525869	hsa-miR-548x	CLIP-seq
MIRT2525870	hsa-miR-548y	CLIP-seq
MIRT2525871	hsa-miR-559	CLIP-seq
MIRT2680356	hsa-miR-566	CLIP-seq
MIRT971965	hsa-miR-582-5p	CLIP-seq
MIRT971967	hsa-miR-588	CLIP-seq
MIRT2525872	hsa-miR-599	CLIP-seq
MIRT2525873	hsa-miR-605	CLIP-seq
MIRT2525874	hsa-miR-607	CLIP-seq
MIRT2525875	hsa-miR-642a	CLIP-seq
MIRT2680357	hsa-miR-655	CLIP-seq
MIRT2525876	hsa-miR-888	CLIP-seq
MIRT2525877	hsa-miR-93	CLIP-seq
MIRT971971	hsa-miR-939	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
AR	Activation	19789348

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12750007
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12750007
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7700648
GO:0005515	Function	Protein binding	IPI	21572435, 21575865, 32911434, 33961781, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	7700648
GO:0007411	Process	Axon guidance	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0007638	Process	Mechanosensory behavior	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12750007
GO:0048935	Process	Peripheral nervous system neuron development	TAS	20096094
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600541	3490	ENSG00000006468

P50549

Protein name

ETS translocation variant 1 (Ets-related protein 81)

Protein function

Transcriptional activator that binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3' (PubMed:7651741). Required for olfactory dopaminergic neuron differentiation; may directly activate expression of tyrosine hydroxylase

PDB

4AVP , 4BNC , 5ILS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04621	ETS_PEA3_N	1 → 333	PEA3 subfamily ETS-domain transcription factor N terminal domain	Family
PF00178	Ets	336 → 415	Ets-domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Very highly expressed in brain, highly expressed in testis, lung and heart, moderately in spleen, small intestine, pancreas and colon, weakly in liver, prostate and thymus, very weakly in skeletal muscle, kidney and ovary and not in pl

Sequence

MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAE
AQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYN
VSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSY
PMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNT
MVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQ
FYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRG
MEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEA
LFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY

Sequence length

477

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (24)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC OSTEONECROSIS OF THE FEMORAL HEAD	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKELETAL EWING SARCOMA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPONDYLOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (68)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	21143918, 21673681, 23512661, 24100634, 25631336, 29483950, 31160676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21143918, 29483950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	36494423	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	18711181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	31381204	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	21087211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29930145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18726892, 22901226		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18628953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	17259299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12947087, 25866208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34286514, 36109787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28211524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	30224643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	30224643		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30224643, 33174020, 35860243	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27278120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	28233365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	BEFREE	9344317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29483950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29483950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	10597226, 10749119, 12736494, 14550555, 30257034, 31381204, 7700648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	22038307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	20927104, 22351694, 23969726, 23977394, 24897389, 24970355, 25572173, 25865047, 26243012, 28539323, 28632504, 29162563, 29245294, 29371979, 29431674 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	23969726, 23977394, 24737027, 29245294, 30557328, 31381204, 32901065, 36241703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31381204, 33470396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28912153, 31862871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	28233365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	27790742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29207642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28672935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	23775959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18726892, 22901226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29483950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16254181, 16585160, 16679847, 16951139, 17108102, 17259299, 17334343, 17390040, 17505060, 17634427, 17671502, 17876339, 18172298, 18483239, 18594527 View all (35 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17173048, 17671502, 27783944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28211524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17690209, 19066166, 19789348, 20160028, 20616363, 23284306, 24100634, 25175425, 25497101, 29431674, 31381204, 31461652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18628953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18726892		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20160028, 24897389, 25073704, 26158900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21087211, 24737027, 26158900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	23626673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	23626673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16211284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10523827, 18726892, 19066166, 20160028, 21036922, 21298110, 21572435, 25073704, 25479232, 25572173, 25631336, 26243012, 26731476, 28233365, 29245294, 30307468, 31160676 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12750007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	31381204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	20534969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	31381204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16254181, 16679847, 17108102, 17334343, 17390040, 17505060, 17634427, 17671502, 17876339, 18172298, 18483239, 18594527, 18711181, 19789348, 20104229 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	23076342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	19789348, 21572435, 23076342, 31160676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17059688, 17259299, 17334343, 17634427, 18483239, 18594527, 18711181, 18794152, 19293179, 20104229, 20693979, 20975660, 21298110, 21703393, 23076342 View all (15 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17173048, 17671502, 27783944		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17390040, 17505060, 17632455, 17634427, 18594527		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	17505060, 17634427, 17671502, 19789348, 23774214, 26731476		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27278120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	27790742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	12186432, 12736494, 17334332, 17620387, 18310898, 24737027, 31381204, 32362012, 9738976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skeletal Ewing sarcoma	Skeletal Ewing Sarcoma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	28211524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	9344317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31461652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21673681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22901226, 29126392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25884720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ETV1 (ETS variant transcription factor 1)