ETS2 (ETS proto-oncogene 2, transcription factor)

Gene

• Entrez ID: 2114
• Gene name: ETS proto-oncogene 2, transcription factor
• Gene symbol: ETS2
• Synonyms (NCBI Gene): ETS2IT1
• Chromosome: 21
• Chromosome location: 21q22.2
• Summary: This gene encodes a transcription factor which regulates genes involved in development and apoptosis. The encoded protein is also a protooncogene and shown to be involved in regulation of telomerase. A pseudogene of this gene is located on the X chromosom

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004398	hsa-miR-199a-5p	Microarray, Northern blot	16331254
MIRT000775	hsa-miR-199a-3p	Microarray, Northern blot	16331254
MIRT024245	hsa-miR-218-5p	Sequencing	20371350
MIRT050649	hsa-miR-18a-5p	CLASH	23622248
MIRT045544	hsa-miR-149-5p	CLASH	23622248
MIRT037225	hsa-miR-877-5p	CLASH	23622248
MIRT053485	hsa-miR-196b-5p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	22298639
MIRT298550	hsa-miR-944	PAR-CLIP	20371350
MIRT563639	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT298547	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT563638	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT298548	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT563637	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT563636	hsa-miR-3671	PAR-CLIP	20371350
MIRT563635	hsa-miR-607	PAR-CLIP	20371350
MIRT085405	hsa-miR-548aa	PAR-CLIP	21572407
MIRT085407	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT085401	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT085408	hsa-miR-548as-3p	PAR-CLIP	21572407
MIRT085409	hsa-miR-548at-3p	PAR-CLIP	21572407
MIRT085410	hsa-miR-548ay-3p	PAR-CLIP	21572407
MIRT085404	hsa-miR-3662	PAR-CLIP	21572407
MIRT085403	hsa-miR-3646	PAR-CLIP	21572407
MIRT085400	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT254150	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT254147	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT254148	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT254149	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT254145	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT254152	hsa-miR-548aw	PAR-CLIP	21572407
MIRT254144	hsa-miR-587	PAR-CLIP	21572407
MIRT298550	hsa-miR-944	PAR-CLIP	20371350
MIRT563639	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT298547	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT563638	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT298548	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT563637	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT563636	hsa-miR-3671	PAR-CLIP	20371350
MIRT563635	hsa-miR-607	PAR-CLIP	20371350
MIRT085405	hsa-miR-548aa	PAR-CLIP	21572407
MIRT085407	hsa-miR-548ap-3p	PAR-CLIP	21572407
MIRT085401	hsa-miR-548t-3p	PAR-CLIP	21572407
MIRT085408	hsa-miR-548as-3p	PAR-CLIP	21572407
MIRT085409	hsa-miR-548at-3p	PAR-CLIP	21572407
MIRT085410	hsa-miR-548ay-3p	PAR-CLIP	21572407
MIRT085404	hsa-miR-3662	PAR-CLIP	21572407
MIRT085403	hsa-miR-3646	PAR-CLIP	21572407
MIRT085400	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT254150	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT254147	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT254148	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT254149	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT254145	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT254152	hsa-miR-548aw	PAR-CLIP	21572407
MIRT254144	hsa-miR-587	PAR-CLIP	21572407
MIRT971887	hsa-miR-1224-3p	CLIP-seq
MIRT971888	hsa-miR-1245b-5p	CLIP-seq
MIRT971889	hsa-miR-1260	CLIP-seq
MIRT971890	hsa-miR-1260b	CLIP-seq
MIRT971891	hsa-miR-1264	CLIP-seq
MIRT971892	hsa-miR-1280	CLIP-seq
MIRT971893	hsa-miR-1283	CLIP-seq
MIRT971894	hsa-miR-136	CLIP-seq
MIRT971895	hsa-miR-188-3p	CLIP-seq
MIRT971896	hsa-miR-188-5p	CLIP-seq
MIRT971897	hsa-miR-203	CLIP-seq
MIRT971898	hsa-miR-300	CLIP-seq
MIRT971899	hsa-miR-3142	CLIP-seq
MIRT971900	hsa-miR-3156-3p	CLIP-seq
MIRT971901	hsa-miR-3187-3p	CLIP-seq
MIRT971902	hsa-miR-323b-5p	CLIP-seq
MIRT971903	hsa-miR-339-5p	CLIP-seq
MIRT971904	hsa-miR-3667-3p	CLIP-seq
MIRT971905	hsa-miR-369-3p	CLIP-seq
MIRT971906	hsa-miR-371-5p	CLIP-seq
MIRT971907	hsa-miR-371b-5p	CLIP-seq
MIRT971908	hsa-miR-374a	CLIP-seq
MIRT971909	hsa-miR-374b	CLIP-seq
MIRT971910	hsa-miR-381	CLIP-seq
MIRT971911	hsa-miR-4252	CLIP-seq
MIRT971912	hsa-miR-4320	CLIP-seq
MIRT971913	hsa-miR-4435	CLIP-seq
MIRT971914	hsa-miR-4475	CLIP-seq
MIRT971915	hsa-miR-450b-5p	CLIP-seq
MIRT971916	hsa-miR-4637	CLIP-seq
MIRT971917	hsa-miR-4640-3p	CLIP-seq
MIRT971918	hsa-miR-4650-5p	CLIP-seq
MIRT971919	hsa-miR-4652-3p	CLIP-seq
MIRT971920	hsa-miR-4666-3p	CLIP-seq
MIRT971921	hsa-miR-4667-3p	CLIP-seq
MIRT971922	hsa-miR-4701-5p	CLIP-seq
MIRT971923	hsa-miR-4717-5p	CLIP-seq
MIRT971924	hsa-miR-4753-3p	CLIP-seq
MIRT971925	hsa-miR-4753-5p	CLIP-seq
MIRT971926	hsa-miR-4766-5p	CLIP-seq
MIRT971927	hsa-miR-518a-5p	CLIP-seq
MIRT971928	hsa-miR-527	CLIP-seq
MIRT971929	hsa-miR-548s	CLIP-seq
MIRT971930	hsa-miR-588	CLIP-seq
MIRT971931	hsa-miR-942	CLIP-seq
MIRT1987949	hsa-miR-101	CLIP-seq
MIRT971889	hsa-miR-1260	CLIP-seq
MIRT971890	hsa-miR-1260b	CLIP-seq
MIRT1987950	hsa-miR-144	CLIP-seq
MIRT1987951	hsa-miR-3138	CLIP-seq
MIRT1987952	hsa-miR-4800-5p	CLIP-seq
MIRT1987953	hsa-miR-598	CLIP-seq
MIRT1987949	hsa-miR-101	CLIP-seq
MIRT1987950	hsa-miR-144	CLIP-seq
MIRT971897	hsa-miR-203	CLIP-seq
MIRT2222364	hsa-miR-205	CLIP-seq
MIRT971902	hsa-miR-323b-5p	CLIP-seq
MIRT2222365	hsa-miR-3922-5p	CLIP-seq
MIRT971916	hsa-miR-4637	CLIP-seq
MIRT971923	hsa-miR-4717-5p	CLIP-seq
MIRT971925	hsa-miR-4753-5p	CLIP-seq
MIRT971926	hsa-miR-4766-5p	CLIP-seq
MIRT2222366	hsa-miR-628-3p	CLIP-seq
MIRT2387548	hsa-miR-1293	CLIP-seq
MIRT2387549	hsa-miR-323-5p	CLIP-seq
MIRT2387550	hsa-miR-4483	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ERF	Repression	7588608
ETV7	Unknown	22615925
JUN	Unknown	22354960

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12637547
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12637547
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	12637547
GO:0001501	Process	Skeletal system development	TAS	8596630
GO:0001712	Process	Ectodermal cell fate commitment	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	10918595
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	8596630
GO:0005515	Function	Protein binding	IPI	18242510, 18598946, 25117710, 26331536, 26496610, 32814053, 32911434
GO:0005634	Component	Nucleus	HDA	16780588
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007498	Process	Mesoderm development	IEA
GO:0019904	Function	Protein domain specific binding	IPI	11583620
GO:0030154	Process	Cell differentiation	IBA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11909962
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IDA	11909962
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	11909962
GO:0090009	Process	Primitive streak formation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 164740
• HGNC: 3489
• e!Ensembl: ENSG00000157557

Protein

• UniProt ID: P15036
• Protein name: Protein C-ets-2
• Protein function: Transcription factor activating transcription. Binds specifically the DNA GGAA/T core motif (Ets-binding site or EBS) in gene promoters and stimulates transcription.
• PDB: 4BQA, 4MHV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02198	SAM_PNT	87 → 170	Sterile alpha motif (SAM)/Pointed domain	Domain
  PF00178	Ets	364 → 443	Ets-domain	Domain

• Sequence:

  MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSIS
  HDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATN
  EFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEE
  NSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFP
  KSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS
  SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
  GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRG
  LRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED

• Sequence length: 469

Pathways

KEGG:

Ras signaling pathway
Human T-cell leukemia virus 1 infection

Reactome:

Oncogene Induced Senescence

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	LHGDN	18094719		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	3941901		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	18094719		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28724426		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23659968, 26880803, 29761525		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23659968		★☆☆☆☆ Found in Text Mining only
Alzheimer disease type 1	Alzheimer disease	BEFREE	2923930		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19179380		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	25993293	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24089231, 34795667, 8660103	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12359648		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	33069695	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17921261, 28624205		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	17921261		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	33990592	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1384656		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	1347193, 15314206, 15387369, 16380248, 17205517, 18586674, 19566835, 20145133, 22179046, 23977064, 9500466		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12628005, 15314206, 18586674, 20554528, 21526717, 23343470, 39796183	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	36760475	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16380248, 29761525		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36614238	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17921261, 28624205		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23659968, 25680408		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26590320	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15387369		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	33757590	Associate	★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	9174050		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	19407855		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	19407855	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11689681, 12511603, 12658630, 22446105		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	12511603		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28742206		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	16523244		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	18942749		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21763315		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28742206	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21343932		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36609474	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	3267212		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	9918849		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30013825		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15063784, 9544840, 9918849		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21946934, 24089231		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	18586674		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down Syndrome	BEFREE	10666682, 11175361, 11573964, 11771756, 12554679, 12890557, 14678752, 1483701, 15063784, 15745955, 16514474, 17168651, 17559337, 18094719, 20535211, 22048266, 24908086, 2529204, 2813360, 2882955, 2902635, 2950593, 8596630, 9307193, 9544840, 9918849		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	18094719, 21526717, 22048266, 22298639, 23343470, 2902635, 30031727	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	12532432	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	12532432	Associate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	36183486	Associate	★☆☆☆☆ Found in Text Mining only
Eye Neoplasms	Eye Neoplasms	BEFREE	18958307		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26143636	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31763674, 7523384		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31763674, 7523384		★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	26590320	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	39796183	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	33156570	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21562315		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36609474	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	10334475		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18958307		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21526717	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15007164, 19666867, 21339820, 28724426, 34655717, 35839275	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	39191856	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15007164, 1728954, 28724426, 3021321, 3267212, 3941901		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12174931, 23416888, 23542016, 23934123, 28043148		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23659968	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25680408	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22354960		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	1347193, 15314206, 16380248, 17205517, 18586674, 19566835, 20145133, 22179046, 23977064		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23659968, 25680408		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15387369		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12560478, 15314206, 17143509, 26880803, 29761525, 29786791, 31487842, 9122038, 9879994		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28481365		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17921261, 28624205		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12560478, 23659968, 23977064, 24218572, 25241894, 28724426, 29332592, 30318758		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21763315		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15788656, 18059336, 18586674		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20145133, 23977064, 9639404		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	18586674		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	10334475		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	19834061		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	23343470	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	1384656		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22260379	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12438253, 12532432, 16737810, 17921261, 18242510, 20145133, 22179046, 22298639, 23659968, 23977064, 26880803, 26893365, 27556183, 28119415, 2813360, 29111780, 9174050		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16737810, 23659968, 26893365		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	33315090	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29021240, 29051386		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15387369		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15387369		★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	2902635		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38486041	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29138297		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12560478, 15314206, 17143509, 26880803, 29761525, 29786791, 31487842, 9122038, 9879994		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12560478, 15314206, 22722839, 22922762, 31487842	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29761525	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21423603	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21562315		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31841990		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11248661, 8660103		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31785145		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	3282128		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12532432		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12532432, 27556183		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28481365		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22298639, 27048589	Associate	★☆☆☆☆ Found in Text Mining only
TOE SYNDACTYLY, TELECANTHUS, AND ANOGENITAL AND RENAL MALFORMATIONS	Toe Syndactyly, Telecanthus, And Anogenital And Renal Malformations	BEFREE	24218572		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	29736687		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24069250	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	36797040	Associate	★☆☆☆☆ Found in Text Mining only