Gene Gene information from NCBI Gene database.
Entrez ID 2110
Gene name Electron transfer flavoprotein dehydrogenase
Gene symbol ETFDH
Synonyms (NCBI Gene)
ETFQOMADD
Chromosome 4
Chromosome location 4q32.1
Summary This gene encodes a component of the electron-transfer system in mitochondria and is essential for electron transfer from a number of mitochondrial flavin-containing dehydrogenases to the main respiratory chain. Mutations in this gene are associated with
SNPs SNP information provided by dbSNP.
53
SNP ID Visualize variation Clinical significance Consequence
rs121964954 G>A Pathogenic Missense variant, coding sequence variant
rs121964955 G>A,C,T Pathogenic Missense variant, coding sequence variant
rs121964956 T>A,C Pathogenic, likely-pathogenic Missense variant, coding sequence variant
rs147219158 G>A Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs199899494 A>T Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
52
miRTarBase ID miRNA Experiments Reference
MIRT628575 hsa-miR-8485 HITS-CLIP 23824327
MIRT628574 hsa-miR-3127-5p HITS-CLIP 23824327
MIRT628575 hsa-miR-8485 HITS-CLIP 23824327
MIRT628574 hsa-miR-3127-5p HITS-CLIP 23824327
MIRT628575 hsa-miR-8485 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0004174 Function Electron-transferring-flavoprotein dehydrogenase activity IBA
GO:0004174 Function Electron-transferring-flavoprotein dehydrogenase activity IDA 8306995, 12049629, 14640977
GO:0004174 Function Electron-transferring-flavoprotein dehydrogenase activity IEA
GO:0004174 Function Electron-transferring-flavoprotein dehydrogenase activity TAS
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
231675 3483 ENSG00000171503
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16134
Protein name Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (ETF-QO) (ETF-ubiquinone oxidoreductase) (EC 1.5.5.1) (Electron-transferring-flavoprotein dehydrogenase) (ETF dehydrogenase)
Protein function Accepts electrons from ETF and reduces ubiquinone.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01946 Thi4 58 121 Family
PF05187 ETF_QO 512 615 Family
Sequence
MLVPLAKLSCLAYQCFHALKIKKNYLPLCATRWSSTSTVPRITTHYTIYPRDKDKRWEGV
NMERFAEEADVVIVGAGPAGLSAAVRLKQLAVAHEKDIRVCLVEKAAQIGAHTLSGACLD
P
GAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLV
SWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGIATNDVGIQKDGAPKATFERGLELHAK
VTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWKPGRVDHTVGWPLD
RHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIA
YGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTS
ENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRG
MEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLR
DDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQN
INWVVPEGGGGPAYN
GM
Sequence length 617
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Respiratory electron transport
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
18
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormality of metabolism/homeostasis Likely pathogenic; Pathogenic rs2150312322, rs773668457 RCV001814448
RCV001814220
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Acyl-CoA dehydrogenase deficiency, glutaric acidemia type II Likely pathogenic; Pathogenic rs377656387 RCV001250164
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ETFDH-related disorder Likely pathogenic; Pathogenic rs767238539, rs796051964, rs796051962, rs761669036, rs1774704214, rs2479076294, rs369711837, rs773668457 RCV003408283
RCV004748625
RCV003398924
RCV004748682
RCV003397028
View all (3 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Glutaric acidemia IIc Pathogenic; Likely pathogenic rs121964953, rs2150304327, rs121964954, rs121964955, rs121964956, rs746598421, rs371493232 RCV000012806
RCV000012807
RCV000012808
RCV000012809
RCV000012810
View all (3 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Distal spinal muscular atrophy Uncertain significance ClinVar
Disgenet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Familial cancer of breast Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Conflicting classifications of pathogenicity; - ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carnitine palmitoyl transferase 2 deficiency Carnitine palmitoyl transferase deficiency BEFREE 20370797, 28083701
★☆☆☆☆
Found in Text Mining only
Carnitine Palmitoyltransferase II Deficiency Infantile Carnitine palmitoyltransferase deficiency Pubtator 34764427 Associate
★☆☆☆☆
Found in Text Mining only
Cholelithiasis Cholecystolithiasis Pubtator 39366640 Associate
★☆☆☆☆
Found in Text Mining only
COENZYME Q10 DEFICIENCY Coenzyme Q10 Deficiency BEFREE 17412732
★☆☆☆☆
Found in Text Mining only
Coenzyme Q10 Deficiency Coenzyme q10 deficiency Pubtator 17412732, 19208393 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 34253750 Associate
★☆☆☆☆
Found in Text Mining only
Congenital hypoplasia of lung Pulmonary hypoplasia HPO_DG
★☆☆☆☆
Found in Text Mining only
Distal myopathy Nonaka type Distal myopathy Pubtator 34440319 Associate
★☆☆☆☆
Found in Text Mining only
Fatty Liver Fatty Liver HPO_DG
★☆☆☆☆
Found in Text Mining only