ESRRG (estrogen related receptor gamma)

Gene

• Entrez ID: 2104
• Gene name: Estrogen related receptor gamma
• Gene symbol: ESRRG
• Synonyms (NCBI Gene): ERR-gamma, ERR3, ERRg, ERRgamma, NR3B3
• Chromosome: 1
• Chromosome location: 1q41
• Summary: This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437839	hsa-miR-205-5p	Luciferase reporter assay	23589079
MIRT437839	hsa-miR-205-5p	Luciferase reporter assay	23589079
MIRT668525	hsa-miR-935	HITS-CLIP	23824327
MIRT668524	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT668523	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT668522	hsa-miR-5580-5p	HITS-CLIP	23824327
MIRT668521	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT668520	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT668519	hsa-miR-4492	HITS-CLIP	23824327
MIRT668518	hsa-miR-4498	HITS-CLIP	23824327
MIRT668517	hsa-miR-5001-5p	HITS-CLIP	23824327
MIRT668516	hsa-miR-762	HITS-CLIP	23824327
MIRT668525	hsa-miR-935	HITS-CLIP	23824327
MIRT668524	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT668523	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT668522	hsa-miR-5580-5p	HITS-CLIP	23824327
MIRT668521	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT668520	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT668519	hsa-miR-4492	HITS-CLIP	23824327
MIRT668518	hsa-miR-4498	HITS-CLIP	23824327
MIRT668517	hsa-miR-5001-5p	HITS-CLIP	23824327
MIRT668516	hsa-miR-762	HITS-CLIP	23824327
MIRT971065	hsa-miR-1267	CLIP-seq
MIRT971066	hsa-miR-1323	CLIP-seq
MIRT971067	hsa-miR-148a	CLIP-seq
MIRT971068	hsa-miR-148b	CLIP-seq
MIRT971069	hsa-miR-152	CLIP-seq
MIRT971070	hsa-miR-200b	CLIP-seq
MIRT971071	hsa-miR-200c	CLIP-seq
MIRT971072	hsa-miR-23a	CLIP-seq
MIRT971073	hsa-miR-23b	CLIP-seq
MIRT971074	hsa-miR-23c	CLIP-seq
MIRT971075	hsa-miR-335	CLIP-seq
MIRT971076	hsa-miR-361-5p	CLIP-seq
MIRT971077	hsa-miR-3688-3p	CLIP-seq
MIRT971078	hsa-miR-3690	CLIP-seq
MIRT971079	hsa-miR-3714	CLIP-seq
MIRT971080	hsa-miR-3941	CLIP-seq
MIRT971081	hsa-miR-3974	CLIP-seq
MIRT971082	hsa-miR-3978	CLIP-seq
MIRT971083	hsa-miR-4251	CLIP-seq
MIRT971084	hsa-miR-4254	CLIP-seq
MIRT971085	hsa-miR-4280	CLIP-seq
MIRT971086	hsa-miR-429	CLIP-seq
MIRT971087	hsa-miR-4424	CLIP-seq
MIRT971088	hsa-miR-4426	CLIP-seq
MIRT971089	hsa-miR-4504	CLIP-seq
MIRT971090	hsa-miR-4514	CLIP-seq
MIRT971091	hsa-miR-4643	CLIP-seq
MIRT971092	hsa-miR-4647	CLIP-seq
MIRT971093	hsa-miR-466	CLIP-seq
MIRT971094	hsa-miR-4662b	CLIP-seq
MIRT971095	hsa-miR-4672	CLIP-seq
MIRT971096	hsa-miR-4684-5p	CLIP-seq
MIRT971097	hsa-miR-4692	CLIP-seq
MIRT971098	hsa-miR-4703-3p	CLIP-seq
MIRT971099	hsa-miR-4704-3p	CLIP-seq
MIRT971100	hsa-miR-4789-3p	CLIP-seq
MIRT971101	hsa-miR-4795-3p	CLIP-seq
MIRT971102	hsa-miR-483-5p	CLIP-seq
MIRT971103	hsa-miR-493	CLIP-seq
MIRT971104	hsa-miR-539	CLIP-seq
MIRT971105	hsa-miR-542-3p	CLIP-seq
MIRT971106	hsa-miR-548o	CLIP-seq
MIRT971107	hsa-miR-563	CLIP-seq
MIRT971108	hsa-miR-622	CLIP-seq
MIRT971109	hsa-miR-940	CLIP-seq
MIRT971110	hsa-miR-942	CLIP-seq
MIRT971070	hsa-miR-200b	CLIP-seq
MIRT971071	hsa-miR-200c	CLIP-seq
MIRT1987691	hsa-miR-329	CLIP-seq
MIRT1987692	hsa-miR-3591-3p	CLIP-seq
MIRT1987693	hsa-miR-362-3p	CLIP-seq
MIRT971086	hsa-miR-429	CLIP-seq
MIRT1987694	hsa-miR-4446-5p	CLIP-seq
MIRT1987695	hsa-miR-4463	CLIP-seq
MIRT1987696	hsa-miR-4494	CLIP-seq
MIRT971089	hsa-miR-4504	CLIP-seq
MIRT1987697	hsa-miR-450b-5p	CLIP-seq
MIRT971090	hsa-miR-4514	CLIP-seq
MIRT971097	hsa-miR-4692	CLIP-seq
MIRT1987698	hsa-miR-4753-3p	CLIP-seq
MIRT1987699	hsa-miR-4768-5p	CLIP-seq
MIRT971105	hsa-miR-542-3p	CLIP-seq
MIRT1987700	hsa-miR-548g	CLIP-seq
MIRT971107	hsa-miR-563	CLIP-seq
MIRT2222110	hsa-miR-132	CLIP-seq
MIRT971070	hsa-miR-200b	CLIP-seq
MIRT971071	hsa-miR-200c	CLIP-seq
MIRT2222111	hsa-miR-212	CLIP-seq
MIRT2222112	hsa-miR-3120-3p	CLIP-seq
MIRT2222113	hsa-miR-3121-5p	CLIP-seq
MIRT2222114	hsa-miR-3134	CLIP-seq
MIRT2222115	hsa-miR-369-3p	CLIP-seq
MIRT971083	hsa-miR-4251	CLIP-seq
MIRT971086	hsa-miR-429	CLIP-seq
MIRT971089	hsa-miR-4504	CLIP-seq
MIRT2222116	hsa-miR-4534	CLIP-seq
MIRT971096	hsa-miR-4684-5p	CLIP-seq
MIRT971099	hsa-miR-4704-3p	CLIP-seq
MIRT1987698	hsa-miR-4753-3p	CLIP-seq
MIRT2222117	hsa-miR-4802-5p	CLIP-seq
MIRT2222118	hsa-miR-4803	CLIP-seq
MIRT2222119	hsa-miR-501-5p	CLIP-seq
MIRT971104	hsa-miR-539	CLIP-seq
MIRT971105	hsa-miR-542-3p	CLIP-seq
MIRT2222120	hsa-miR-561	CLIP-seq
MIRT971107	hsa-miR-563	CLIP-seq
MIRT2222121	hsa-miR-922	CLIP-seq
MIRT971072	hsa-miR-23a	CLIP-seq
MIRT971073	hsa-miR-23b	CLIP-seq
MIRT971074	hsa-miR-23c	CLIP-seq
MIRT2222112	hsa-miR-3120-3p	CLIP-seq
MIRT971083	hsa-miR-4251	CLIP-seq
MIRT2222122	hsa-miR-4270	CLIP-seq
MIRT2222123	hsa-miR-4441	CLIP-seq
MIRT1987697	hsa-miR-450b-5p	CLIP-seq
MIRT971101	hsa-miR-4795-3p	CLIP-seq
MIRT2437101	hsa-miR-3914	CLIP-seq
MIRT2437102	hsa-miR-4420	CLIP-seq
MIRT2437103	hsa-miR-4642	CLIP-seq
MIRT2437104	hsa-miR-4720-5p	CLIP-seq
MIRT2437105	hsa-miR-4799-3p	CLIP-seq
MIRT2437106	hsa-miR-656	CLIP-seq
MIRT2437107	hsa-miR-873	CLIP-seq
MIRT2437101	hsa-miR-3914	CLIP-seq
MIRT2437107	hsa-miR-873	CLIP-seq
MIRT2448965	hsa-miR-1294	CLIP-seq
MIRT2448966	hsa-miR-205	CLIP-seq
MIRT2448967	hsa-miR-3174	CLIP-seq
MIRT2448968	hsa-miR-3658	CLIP-seq
MIRT971088	hsa-miR-4426	CLIP-seq
MIRT971092	hsa-miR-4647	CLIP-seq
MIRT971094	hsa-miR-4662b	CLIP-seq
MIRT2448969	hsa-miR-548c-3p	CLIP-seq
MIRT2448970	hsa-miR-921	CLIP-seq
MIRT2448965	hsa-miR-1294	CLIP-seq
MIRT2448967	hsa-miR-3174	CLIP-seq
MIRT2448968	hsa-miR-3658	CLIP-seq
MIRT971088	hsa-miR-4426	CLIP-seq
MIRT971092	hsa-miR-4647	CLIP-seq
MIRT971094	hsa-miR-4662b	CLIP-seq
MIRT2448970	hsa-miR-921	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NR0B1	Repression	16314306
SIRT1	Activation	19690166

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	10428842, 18063693, 19171140, 19914244, 20211142, 25416956, 32296183, 33961781, 38225382
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	23836911
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0034056	Function	Estrogen response element binding	IBA
GO:0034056	Function	Estrogen response element binding	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0050682	Function	AF-2 domain binding	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	17229846
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 602969
• HGNC: 3474
• e!Ensembl: ENSG00000196482

Protein

• UniProt ID: P62508
• Protein name: Estrogen-related receptor gamma (ERR gamma-2) (Estrogen receptor-related protein 3) (Nuclear receptor subfamily 3 group B member 3)
• Protein function: Orphan receptor that acts as a transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements (By similarity). Induces the expressi
• PDB: 1KV6, 1TFC, 1VJB, 2E2R, 2EWP, 2GP7, 2GPO, 2GPP, 2GPU, 2GPV, 2P7A, 2P7G, 2P7Z, 2ZAS, 2ZBS, 2ZKC, 5YSO, 6A6K, 6I61, 6I62, 6I63, 6I64, 6I65, 6I66, 6I67, 6K3N, 6KNR, 6XXC, 6XY5, 6Y18, 6Y1D, 6Y3W, 6Y58, 8B4Q, 8BJG, 8BJN, 8BM5, 8IFO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00105	zf-C4	126 → 195	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	255 → 441	Ligand-binding domain of nuclear hormone receptor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the heart, kidney, brain, lung, bone marrow, adrenal gland, trachea, spinal cord and thyroid gland. {ECO:0000269|PubMed:14651967, ECO:0000269|PubMed:9676434}.
• Sequence:

  MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
  SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
  NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
  QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
  LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
  LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
  LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
  LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

• Sequence length: 458

Pathways

Reactome:

Nuclear Receptor transcription pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian insufficiency	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONGUE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	16681769		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30657313, 31010838		★☆☆☆☆ Found in Text Mining only
Autosomal dominant compelling helio ophthalmic outburst syndrome	Achoo syndrome	GWASCAT_DG	27182965		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12438245, 19415745, 20883782, 21153485, 23977052, 24125170, 25971350, 29940916		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18974135, 20889127, 23977052, 24684682, 25971350, 29940916, 35092367	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16681769, 26940882	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37679788	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25940592	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26940882	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27128972, 30131446	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	37802074	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29735694		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	27128972		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30131446		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	34883250	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29247173, 29366446		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	27381092	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34883250	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22549789		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	23589079		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23051957, 23589079, 25068805		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16681769, 23051957	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	39678195	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37679788	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	31479733		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	27381092		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	27381092	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	19471316	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35418170	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	22549789		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19965931		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	24083978		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	24083978		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23050013, 35594451	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36787804	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29735694		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	29735694		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31002184		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25940592, 26940882		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	24687322	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26940882	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29071344		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	12438245, 19415745, 20883782, 21153485, 23977052, 24125170, 25971350, 29940916		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23051957, 25068805		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26940882		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27821488, 29360794		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29765046		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29765046		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28209382		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	34380431	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26940882, 29765046, 30171186, 31002184		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29862528		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	11705994, 27113491	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25910584, 27113491, 30019168		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	25971350		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30076703		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	19821770	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31692519		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34089362	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28780078		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precocious Puberty	Precocious puberty	BEFREE	29293544		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27821488, 29360794		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20128821	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	34883250	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30131446		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31002184, 35794182	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29765046		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32571331, 37653798	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27038254	Associate	★☆☆☆☆ Found in Text Mining only