Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2101
Gene name	Estrogen related receptor alpha
Gene symbol	ESRRA
Synonyms (NCBI Gene)	ERR1ERRaERRalphaESRL1NR3B1
Chromosome	11
Chromosome location	11q13.1
Summary	The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate t

183

Show/Hide all (183)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006957	hsa-miR-137	Luciferase reporter assay	22723937
MIRT006957	hsa-miR-137	Luciferase reporter assay	22723937
MIRT016687	hsa-miR-423-3p	Sequencing	20371350
MIRT020579	hsa-miR-155-5p	Proteomics	18668040
MIRT028410	hsa-miR-30a-5p	Proteomics	18668040
MIRT039942	hsa-miR-615-3p	CLASH	23622248
MIRT437906	hsa-miR-125a-5p	Luciferase reporter assayWestern blot	25266720
MIRT732379	hsa-miR-135a-5p	Luciferase reporter assayqRT-PCRWestern blot	27227989
MIRT732379	hsa-miR-135a-5p	Luciferase reporter assayqRT-PCRWestern blot	27227989
MIRT970988	hsa-miR-103a	CLIP-seq
MIRT970989	hsa-miR-107	CLIP-seq
MIRT970990	hsa-miR-125b	CLIP-seq
MIRT970991	hsa-miR-1301	CLIP-seq
MIRT970992	hsa-miR-135a	CLIP-seq
MIRT970993	hsa-miR-135b	CLIP-seq
MIRT970994	hsa-miR-1470	CLIP-seq
MIRT970995	hsa-miR-15a	CLIP-seq
MIRT970996	hsa-miR-15b	CLIP-seq
MIRT970997	hsa-miR-16	CLIP-seq
MIRT970998	hsa-miR-195	CLIP-seq
MIRT970999	hsa-miR-1973	CLIP-seq
MIRT971000	hsa-miR-3117-5p	CLIP-seq
MIRT971001	hsa-miR-3127-3p	CLIP-seq
MIRT971002	hsa-miR-3159	CLIP-seq
MIRT971003	hsa-miR-3176	CLIP-seq
MIRT971004	hsa-miR-3192	CLIP-seq
MIRT971005	hsa-miR-323-3p	CLIP-seq
MIRT971006	hsa-miR-324-5p	CLIP-seq
MIRT971007	hsa-miR-365	CLIP-seq
MIRT971008	hsa-miR-3922-3p	CLIP-seq
MIRT971009	hsa-miR-3922-5p	CLIP-seq
MIRT971010	hsa-miR-3943	CLIP-seq
MIRT971011	hsa-miR-3944-5p	CLIP-seq
MIRT971012	hsa-miR-3977	CLIP-seq
MIRT971013	hsa-miR-424	CLIP-seq
MIRT971014	hsa-miR-4267	CLIP-seq
MIRT971015	hsa-miR-4313	CLIP-seq
MIRT971016	hsa-miR-4319	CLIP-seq
MIRT971017	hsa-miR-4324	CLIP-seq
MIRT971018	hsa-miR-4464	CLIP-seq
MIRT971019	hsa-miR-4503	CLIP-seq
MIRT971020	hsa-miR-4522	CLIP-seq
MIRT971021	hsa-miR-4667-3p	CLIP-seq
MIRT971022	hsa-miR-4708-3p	CLIP-seq
MIRT971023	hsa-miR-4727-5p	CLIP-seq
MIRT971024	hsa-miR-4732-3p	CLIP-seq
MIRT971025	hsa-miR-4748	CLIP-seq
MIRT971026	hsa-miR-4753-3p	CLIP-seq
MIRT971027	hsa-miR-4757-5p	CLIP-seq
MIRT971028	hsa-miR-4768-5p	CLIP-seq
MIRT971029	hsa-miR-4798-5p	CLIP-seq
MIRT971030	hsa-miR-497	CLIP-seq
MIRT971031	hsa-miR-5047	CLIP-seq
MIRT971032	hsa-miR-532-3p	CLIP-seq
MIRT971033	hsa-miR-544	CLIP-seq
MIRT971034	hsa-miR-545	CLIP-seq
MIRT971035	hsa-miR-548p	CLIP-seq
MIRT971036	hsa-miR-642a	CLIP-seq
MIRT971037	hsa-miR-662	CLIP-seq
MIRT971038	hsa-miR-670	CLIP-seq
MIRT1987664	hsa-miR-1202	CLIP-seq
MIRT970990	hsa-miR-125b	CLIP-seq
MIRT1987665	hsa-miR-1291	CLIP-seq
MIRT970994	hsa-miR-1470	CLIP-seq
MIRT1987666	hsa-miR-214	CLIP-seq
MIRT1987667	hsa-miR-2861	CLIP-seq
MIRT971001	hsa-miR-3127-3p	CLIP-seq
MIRT1987668	hsa-miR-3150b-3p	CLIP-seq
MIRT1987669	hsa-miR-3173-5p	CLIP-seq
MIRT1987670	hsa-miR-3194-5p	CLIP-seq
MIRT1987671	hsa-miR-3198	CLIP-seq
MIRT1987672	hsa-miR-326	CLIP-seq
MIRT1987673	hsa-miR-330-5p	CLIP-seq
MIRT1987674	hsa-miR-3619-5p	CLIP-seq
MIRT1987675	hsa-miR-3688-5p	CLIP-seq
MIRT1987676	hsa-miR-3972	CLIP-seq
MIRT971014	hsa-miR-4267	CLIP-seq
MIRT1987677	hsa-miR-4309	CLIP-seq
MIRT971015	hsa-miR-4313	CLIP-seq
MIRT971016	hsa-miR-4319	CLIP-seq
MIRT971017	hsa-miR-4324	CLIP-seq
MIRT971018	hsa-miR-4464	CLIP-seq
MIRT1987678	hsa-miR-4530	CLIP-seq
MIRT1987679	hsa-miR-4640-3p	CLIP-seq
MIRT971021	hsa-miR-4667-3p	CLIP-seq
MIRT1987680	hsa-miR-4690-5p	CLIP-seq
MIRT1987681	hsa-miR-4695-5p	CLIP-seq
MIRT1987682	hsa-miR-4722-3p	CLIP-seq
MIRT971024	hsa-miR-4732-3p	CLIP-seq
MIRT971025	hsa-miR-4748	CLIP-seq
MIRT1987683	hsa-miR-4784	CLIP-seq
MIRT971036	hsa-miR-642a	CLIP-seq
MIRT971038	hsa-miR-670	CLIP-seq
MIRT1987684	hsa-miR-761	CLIP-seq
MIRT1987685	hsa-miR-765	CLIP-seq
MIRT970988	hsa-miR-103a	CLIP-seq
MIRT970989	hsa-miR-107	CLIP-seq
MIRT2222082	hsa-miR-1272	CLIP-seq
MIRT2222083	hsa-miR-1285	CLIP-seq
MIRT1987665	hsa-miR-1291	CLIP-seq
MIRT970991	hsa-miR-1301	CLIP-seq
MIRT970992	hsa-miR-135a	CLIP-seq
MIRT970993	hsa-miR-135b	CLIP-seq
MIRT2222084	hsa-miR-1915	CLIP-seq
MIRT1987667	hsa-miR-2861	CLIP-seq
MIRT2222085	hsa-miR-296-5p	CLIP-seq
MIRT971000	hsa-miR-3117-5p	CLIP-seq
MIRT2222086	hsa-miR-3121-3p	CLIP-seq
MIRT2222087	hsa-miR-3121-5p	CLIP-seq
MIRT2222088	hsa-miR-3179	CLIP-seq
MIRT2222089	hsa-miR-3187-5p	CLIP-seq
MIRT2222090	hsa-miR-3189-5p	CLIP-seq
MIRT1987671	hsa-miR-3198	CLIP-seq
MIRT971005	hsa-miR-323-3p	CLIP-seq
MIRT971006	hsa-miR-324-5p	CLIP-seq
MIRT1987672	hsa-miR-326	CLIP-seq
MIRT1987673	hsa-miR-330-5p	CLIP-seq
MIRT2222091	hsa-miR-3622b-5p	CLIP-seq
MIRT971007	hsa-miR-365	CLIP-seq
MIRT2222092	hsa-miR-3691-3p	CLIP-seq
MIRT2222093	hsa-miR-378g	CLIP-seq
MIRT971012	hsa-miR-3977	CLIP-seq
MIRT2222094	hsa-miR-4253	CLIP-seq
MIRT1987677	hsa-miR-4309	CLIP-seq
MIRT971015	hsa-miR-4313	CLIP-seq
MIRT2222095	hsa-miR-432	CLIP-seq
MIRT971017	hsa-miR-4324	CLIP-seq
MIRT2222096	hsa-miR-4327	CLIP-seq
MIRT2222097	hsa-miR-4422	CLIP-seq
MIRT971018	hsa-miR-4464	CLIP-seq
MIRT2222098	hsa-miR-4486	CLIP-seq
MIRT2222099	hsa-miR-4653-3p	CLIP-seq
MIRT2222100	hsa-miR-4688	CLIP-seq
MIRT971022	hsa-miR-4708-3p	CLIP-seq
MIRT2222101	hsa-miR-4712-3p	CLIP-seq
MIRT971023	hsa-miR-4727-5p	CLIP-seq
MIRT971025	hsa-miR-4748	CLIP-seq
MIRT971026	hsa-miR-4753-3p	CLIP-seq
MIRT2222102	hsa-miR-4758-3p	CLIP-seq
MIRT971028	hsa-miR-4768-5p	CLIP-seq
MIRT2222103	hsa-miR-486-3p	CLIP-seq
MIRT971031	hsa-miR-5047	CLIP-seq
MIRT2222104	hsa-miR-515-5p	CLIP-seq
MIRT971032	hsa-miR-532-3p	CLIP-seq
MIRT971033	hsa-miR-544	CLIP-seq
MIRT971034	hsa-miR-545	CLIP-seq
MIRT2222105	hsa-miR-593	CLIP-seq
MIRT2222106	hsa-miR-612	CLIP-seq
MIRT971037	hsa-miR-662	CLIP-seq
MIRT2222107	hsa-miR-760	CLIP-seq
MIRT1987685	hsa-miR-765	CLIP-seq
MIRT1987671	hsa-miR-3198	CLIP-seq
MIRT1987677	hsa-miR-4309	CLIP-seq
MIRT1987669	hsa-miR-3173-5p	CLIP-seq
MIRT1987669	hsa-miR-3173-5p	CLIP-seq
MIRT971018	hsa-miR-4464	CLIP-seq
MIRT971023	hsa-miR-4727-5p	CLIP-seq
MIRT971025	hsa-miR-4748	CLIP-seq
MIRT971032	hsa-miR-532-3p	CLIP-seq
MIRT971033	hsa-miR-544	CLIP-seq
MIRT971037	hsa-miR-662	CLIP-seq
MIRT2680306	hsa-miR-1268	CLIP-seq
MIRT2680307	hsa-miR-1268b	CLIP-seq
MIRT2222084	hsa-miR-1915	CLIP-seq
MIRT1987667	hsa-miR-2861	CLIP-seq
MIRT1987668	hsa-miR-3150b-3p	CLIP-seq
MIRT2680308	hsa-miR-3151	CLIP-seq
MIRT2680309	hsa-miR-4266	CLIP-seq
MIRT971018	hsa-miR-4464	CLIP-seq
MIRT1987679	hsa-miR-4640-3p	CLIP-seq
MIRT2680310	hsa-miR-4656	CLIP-seq
MIRT1987681	hsa-miR-4695-5p	CLIP-seq
MIRT2680311	hsa-miR-4716-3p	CLIP-seq
MIRT2680312	hsa-miR-4723-5p	CLIP-seq
MIRT2680313	hsa-miR-4726-3p	CLIP-seq
MIRT971023	hsa-miR-4727-5p	CLIP-seq
MIRT971025	hsa-miR-4748	CLIP-seq
MIRT2680314	hsa-miR-4779	CLIP-seq
MIRT1987683	hsa-miR-4784	CLIP-seq
MIRT971032	hsa-miR-532-3p	CLIP-seq
MIRT971033	hsa-miR-544	CLIP-seq
MIRT971037	hsa-miR-662	CLIP-seq
MIRT1987685	hsa-miR-765	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ESR1	Unknown	12960079

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	21190936
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	12522104, 15337744, 18063693, 18331830, 18441008, 18509053, 21190936, 21988832, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21190936
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	21190936
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	23836911
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0019904	Function	Protein domain specific binding	IPI	11984006
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0034056	Function	Estrogen response element binding	IBA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23836911
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
601998	3471	ENSG00000173153

P11474

Protein name

Steroid hormone receptor ERR1 (Estrogen receptor-like 1) (Estrogen-related receptor alpha) (ERR-alpha) (Nuclear receptor subfamily 3 group B member 1)

Protein function

Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promo

PDB

1XB7 , 2PJL , 3D24 , 3K6P , 7E2E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	77 → 146	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	224 → 404	Ligand-binding domain of nuclear hormone receptor	Domain

Sequence

MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
MMD

Sequence length

423

Interactions

View interactions

	Reactome
			PPARA activates gene expression Transcriptional activation of mitochondrial biogenesis Nuclear Receptor transcription pathway Regulation of RUNX2 expression and activity

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (138)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	16681769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31564971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	30140998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	23123734	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	26312764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	23123734, 26312764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	33753865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27264242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	23123734, 26312764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	21506092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29848990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28711948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29599373, 30977157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12438245, 15231680, 19138740, 19429439, 19462000, 19491275, 19622763, 20674386, 20961995, 21546870, 22014575, 22723937, 23403054, 23656512, 25643697 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20961995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17259347, 17556356, 17631492, 18174157, 18974123, 19462000, 20211987, 20870744, 21546870, 22014575, 22723937, 23725143, 26542058, 27227989, 27456360 View all (9 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	16681769, 26639757, 33197888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	34003583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29214989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29599373, 30977157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31564971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21447778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27128972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21447778, 21949640, 24419103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30342030		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21546870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21546870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	27128972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23720198, 30185207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23680656, 29552224, 30254608, 31737118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23680656, 35048632, 36026615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21825219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31423259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	37347142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21506092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30811808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30811808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	25170024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22778543, 28346099, 29216352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25170024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16755280, 29216352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	24216484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	23680656, 29216352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16464951, 29781387, 30127640, 30706380, 31040369, 31686835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16681769, 31040369, 33197888, 33525981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29781387, 36835419	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21447778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	39394558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29635284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	40113187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34184087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28222026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30322948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	19061896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	21825219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	24825877	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18974123	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	29216352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30254608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	23562079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	21731503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoinsulinaemia (disorder)	Hypoinsulinemia	BEFREE	21731503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28222026	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36787804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	25170024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30698047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29545177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20447055, 36430689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36430689	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12438245, 15231680, 19138740, 19429439, 19462000, 19491275, 19622763, 20674386, 20961995, 21546870, 22014575, 22723937, 23403054, 23656512, 25643697 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20961995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16464951, 29781387, 30127640, 31040369, 31686835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23836899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31564971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21949640, 24419103, 24504521, 27498368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27227989, 27264242, 29094395, 30042415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29599373, 30977157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19429439, 21546870, 23680656, 23720198, 27227989, 27498368, 30588094, 31769969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21546870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23720198, 29216352, 30185207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20961995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18974123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19622763, 22014575, 22723937, 25643697, 29190800, 30478447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20961995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20961995		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28596418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	CTD_human_DG	16515477		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic syndrome	Pubtator	17556356, 19462000, 28346099	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	LHGDN	18778951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	29945885, 30811808, 31769969		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	28346099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19061896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	15883633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	30462217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28771799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19491275, 21546870, 21949640, 22014575, 22723937, 23123734, 23680656, 24419103, 25912138, 26160845, 26312764, 26351140, 26639757, 27402251, 27498368 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25912138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25912138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32683181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	23562079, 29635284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29862528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16286534, 16755280, 28444662, 29216352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16286534, 29216352, 33185172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	36134662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21506092	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	15883633, 17556356, 22957024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	20674386, 22957024, 25903400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	CTD_human_DG	24967384		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	27231954, 27532429		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	27532429, 35918761	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	21949640		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17509876		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24419103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21949640, 24504521, 27966445, 34089362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	30140998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	30698047		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	30698047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27264242, 29094395, 30042415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17294452, 18697814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18697814	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20128821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31423259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29545177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	31862890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31811028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27250523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26639757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26639757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31564971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29476880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29635284		★★★★★ ★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	30920960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23516535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19536094, 23516535, 27494611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26160845, 26542058, 28525844, 28715872, 28890840, 31427441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26542058, 31427441, 32717915, 33753865, 37163498, 37796506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	23123734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17504382, 21546870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ESRRA (estrogen related receptor alpha)