ESR2 (estrogen receptor 2)

Gene

• Entrez ID: 2100
• Gene name: Estrogen receptor 2
• Gene symbol: ESR2
• Synonyms (NCBI Gene): ER-BETA, ESR-BETA, ESRB, ESTRB, Erb, NR3A2, ODG8
• Chromosome: 14
• Chromosome location: 14q23.2-q23.3
• Summary: This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cyto

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1567753148	T>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004563	hsa-miR-92a-3p	GFP reporter assay	20484043
MIRT017943	hsa-miR-335-5p	Microarray	18185580
MIRT054508	hsa-miR-30a-5p	Luciferase reporter assay, Microarray, Next Generation Sequencing (NGS), Western blot	24525454
MIRT683407	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT683406	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT683405	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT683404	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT683403	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT683402	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT683401	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT683400	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT683399	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT683398	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT683397	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT683396	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT683395	hsa-miR-302e	HITS-CLIP	23313552
MIRT683394	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT683393	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT683392	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT683391	hsa-miR-520b	HITS-CLIP	23313552
MIRT683390	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT683389	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT683388	hsa-miR-520e	HITS-CLIP	23313552
MIRT514543	hsa-miR-4438	HITS-CLIP	23313552
MIRT683387	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT683386	hsa-miR-140-5p	HITS-CLIP	23313552
MIRT683385	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT683384	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT683383	hsa-miR-520h	HITS-CLIP	23313552
MIRT683382	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT683381	hsa-miR-1224-3p	HITS-CLIP	23313552
MIRT683380	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT683379	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT683378	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT683377	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT683376	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT683375	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683374	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT683373	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT683372	hsa-miR-203a-5p	HITS-CLIP	23313552
MIRT514532	hsa-miR-5095	HITS-CLIP	23313552
MIRT514533	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT683371	hsa-miR-6726-3p	HITS-CLIP	23313552
MIRT683370	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT514543	hsa-miR-4438	PAR-CLIP	23446348
MIRT514542	hsa-miR-3126-3p	PAR-CLIP	23446348
MIRT514541	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514540	hsa-miR-3176	PAR-CLIP	23446348
MIRT514539	hsa-miR-3922-3p	PAR-CLIP	23446348
MIRT514538	hsa-miR-4312	PAR-CLIP	23446348
MIRT514536	hsa-miR-2052	PAR-CLIP	23446348
MIRT514537	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT514535	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT514534	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT514532	hsa-miR-5095	PAR-CLIP	23446348
MIRT514533	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514531	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT683407	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT683406	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT683405	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT683404	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT683403	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT683402	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT683401	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT683400	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT683399	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT683398	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT683397	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT683396	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT683395	hsa-miR-302e	HITS-CLIP	23313552
MIRT683394	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT683393	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT683392	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT683391	hsa-miR-520b	HITS-CLIP	23313552
MIRT683390	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT683389	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT683388	hsa-miR-520e	HITS-CLIP	23313552
MIRT514543	hsa-miR-4438	HITS-CLIP	23313552
MIRT683387	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT683386	hsa-miR-140-5p	HITS-CLIP	23313552
MIRT683385	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT683384	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT683383	hsa-miR-520h	HITS-CLIP	23313552
MIRT683382	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT683381	hsa-miR-1224-3p	HITS-CLIP	23313552
MIRT683380	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT683379	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT683378	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT683377	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT683376	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT683375	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683374	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT683373	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT683372	hsa-miR-203a-5p	HITS-CLIP	23313552
MIRT514532	hsa-miR-5095	HITS-CLIP	23313552
MIRT514533	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT683371	hsa-miR-6726-3p	HITS-CLIP	23313552
MIRT683370	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT514543	hsa-miR-4438	PAR-CLIP	23446348
MIRT514542	hsa-miR-3126-3p	PAR-CLIP	23446348
MIRT514541	hsa-miR-3190-5p	PAR-CLIP	23446348
MIRT514540	hsa-miR-3176	PAR-CLIP	23446348
MIRT514539	hsa-miR-3922-3p	PAR-CLIP	23446348
MIRT514538	hsa-miR-4312	PAR-CLIP	23446348
MIRT514536	hsa-miR-2052	PAR-CLIP	23446348
MIRT514537	hsa-miR-19a-5p	PAR-CLIP	23446348
MIRT514535	hsa-miR-19b-1-5p	PAR-CLIP	23446348
MIRT514534	hsa-miR-19b-2-5p	PAR-CLIP	23446348
MIRT514532	hsa-miR-5095	PAR-CLIP	23446348
MIRT514533	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT514531	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT970726	hsa-miR-4724-5p	CLIP-seq
MIRT970727	hsa-miR-7	CLIP-seq
MIRT970728	hsa-miR-3155	CLIP-seq
MIRT970729	hsa-miR-3155b	CLIP-seq
MIRT970730	hsa-miR-4265	CLIP-seq
MIRT970731	hsa-miR-4296	CLIP-seq
MIRT970732	hsa-miR-4322	CLIP-seq
MIRT970733	hsa-miR-4417	CLIP-seq
MIRT970734	hsa-miR-4640-5p	CLIP-seq
MIRT970735	hsa-miR-4726-5p	CLIP-seq
MIRT970736	hsa-miR-4786-3p	CLIP-seq
MIRT970737	hsa-miR-484	CLIP-seq
MIRT970738	hsa-miR-603	CLIP-seq
MIRT970739	hsa-miR-642b	CLIP-seq
MIRT1987595	hsa-miR-1295	CLIP-seq
MIRT1987596	hsa-miR-219-1-3p	CLIP-seq
MIRT1987597	hsa-miR-4717-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT3	Activation	21546410
STAT5B	Unknown	11731618

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15345745
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	15345745
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9636657
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	TAS	10749889
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	19126643
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	NAS	9671811
GO:0005496	Function	Steroid binding	IEA
GO:0005496	Function	Steroid binding	ISS
GO:0005496	Function	Steroid binding	TAS	11181953
GO:0005515	Function	Protein binding	IPI	11279242, 12904255, 14764652, 15199063, 18312651, 19022902, 19126643, 20074560, 21629692, 21951318, 24722188, 25416956, 25910212, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19126643, 20074560
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	11181953
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005739	Component	Mitochondrion	IDA	15024130
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	11181953
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007165	Process	Signal transduction	TAS	8769313, 10749889
GO:0007267	Process	Cell-cell signaling	TAS	8769313
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0019899	Function	Enzyme binding	IPI	12039952
GO:0030284	Function	Nuclear estrogen receptor activity	IDA	19126643, 24033289
GO:0030284	Function	Nuclear estrogen receptor activity	IEA
GO:0030284	Function	Nuclear estrogen receptor activity	IMP	29261182, 30113650
GO:0030284	Function	Nuclear estrogen receptor activity	TAS	11181953
GO:0030308	Process	Negative regulation of cell growth	NAS	11181953
GO:0030520	Process	Estrogen receptor signaling pathway	IBA
GO:0030520	Process	Estrogen receptor signaling pathway	IDA	24033289
GO:0030520	Process	Estrogen receptor signaling pathway	IEA
GO:0030520	Process	Estrogen receptor signaling pathway	TAS	11181953
GO:0034056	Function	Estrogen response element binding	IBA
GO:0034056	Function	Estrogen response element binding	IDA	15345745, 19126643, 24033289
GO:0034056	Function	Estrogen response element binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	20074560
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24033289
GO:0046872	Function	Metal ion binding	IEA
GO:0048019	Function	Receptor antagonist activity	NAS	9671811
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	10681512
GO:0071392	Process	Cellular response to estradiol stimulus	IDA	24033289
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA

Other IDs

• MIM: 601663
• HGNC: 3468
• e!Ensembl: ENSG00000140009

Protein

• UniProt ID: Q92731
• Protein name: Estrogen receptor beta (ER-beta) (Nuclear receptor subfamily 3 group A member 2)
• Protein function: Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1/ER-alpha, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). {ECO:0000269|P
• PDB: 1L2J, 1NDE, 1QKM, 1U3Q, 1U3R, 1U3S, 1U9E, 1X76, 1X78, 1X7B, 1X7J, 1YY4, 1YYE, 1ZAF, 2FSZ, 2GIU, 2I0G, 2JJ3, 2NV7, 2QTU, 2YJD, 2YLY, 2Z4B, 3OLL, 3OLS, 3OMO, 3OMP, 3OMQ, 4J24, 4J26, 4ZI1, 5TOA, 7XVY, 7XVZ, 7XWP, 7XWQ, 7XWR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12497	ERbeta_N	12 → 125	Estrogen receptor beta	Family
  PF00105	zf-C4	147 → 216	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	283 → 482	Ligand-binding domain of nuclear hormone receptor	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: Expressed in testis and ovary, and at a lower level in heart, brain, placenta, liver, skeletal muscle, spleen, thymus, prostate, colon, bone marrow, mammary gland and uterus. Also found in uterine bone, breast, and ovarian
• Sequence:

  MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
  NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
  RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
  NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
  CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
  LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
  VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
  DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
  CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ

• Sequence length: 530

Pathways

KEGG:

Endocrine resistance
Hormone signaling
Estrogen signaling pathway
Prolactin signaling pathway
GnRH secretion
Pathways in cancer
Chemical carcinogenesis - receptor activation
Breast cancer

Reactome:

PIP3 activates AKT signaling
Constitutive Signaling by Aberrant PI3K in Cancer
Nuclear Receptor transcription pathway
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
ESR-mediated signaling
Extra-nuclear estrogen signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Ovarian dysgenesis 8	Pathogenic	rs1567753148	RCV000721932	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARRHYTHMIAS, CARDIAC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESR2-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOSPADIAS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY WITH AZOOSPERMIA OR OLIGOZOOSPERMIA DUE TO SINGLE GENE MUTATION	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC INTRAEPITHELIAL NEOPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
46, XY Disorders of Sex Development	46, XY disorder of sex development	BEFREE	29261182		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29550797		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12073050, 12168823, 12497580, 14674142, 15517897, 17046193, 18620727		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12497580, 15900599, 17046193, 19875957, 22583357, 23362007, 29390981		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	17639508		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	25683270, 28889324		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19064969, 19706809, 20615575, 21862684, 26301798, 29970138, 30864727		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	30373552, 30701026		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	12152165, 12497580, 15900599, 29984337		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	17639508		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	24704270		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	17639508		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	17639508		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	22645077		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	20446826, 28681123, 29132333		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	26708506		★☆☆☆☆ Found in Text Mining only
Adolescent Gynecomastia	Pubertal gynecomastia	BEFREE	21597315		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	LHGDN	18508999		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	LHGDN	16216906, 18157729		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33981288	Associate	★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	29032728		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	28052027		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19008315, 19117011, 22439007, 25885794, 28877739		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	21351254		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	27737359		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18288931, 22156442	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	28389656	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	31332160		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29807145		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	12152165		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	15637090		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	21520258, 21691901, 22002330, 27755497, 27840943		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	12750263	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30046904		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	11803451, 20375995, 9851804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	24031087, 25385158, 29567265, 31331849		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	21570196, 24031087, 25385158, 29567265, 31331849		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	21570196	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	21119710		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28439009		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17110088, 17272673, 18566345, 18939943, 23480168, 23519120, 27171902, 29975924		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15618247, 31055232		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	31616008	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16815861, 30174672	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27188427, 27808402, 31617730, 31638834		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31617730	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31638834	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15141349	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	26587829	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16608893		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17110088, 17272673, 18566345, 18939943, 23480168, 23519120, 27171902, 29975924		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17110088	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	22544366, 28416818, 29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASDB_DG	22544366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28299627, 28673581, 29526366, 30510526		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28299627, 30123446		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22466402, 27183630, 27549171		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	29481981		★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	21823190		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24470591, 25885794		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	15517897	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	27272795, 29320480, 9824210		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11596023, 17908481, 20133657, 27866977, 28181685, 30708032, 31238046		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	20172949		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	20172949	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11807414		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16700038		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	16700038		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22965848, 24148819, 26556868, 28362839, 29789714, 30459405, 31076571		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	26590813	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	37418975	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	28440874		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	15141349, 23711151	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10554009, 10554010, 10601611, 10690532, 10759732, 10763153, 11162931, 11165756, 11818203, 12454770, 12846425, 12889601, 14517838, 14576822, 14633679, 14729654, 15325017, 15374639, 15477865, 15522549, 15591034, 15604249, 15613450, 16010412, 16118406, 16261413, 16322330, 16596234, 16615154, 16723304, 16728566, 16808847, 16951146, 17009105, 17095148, 17145865, 17428314, 17617929, 17638070, 17640362, 17876701, 17889406, 17904846, 17935138, 18026833, 18405391, 19082882, 19148525, 19298602, 19321582, 19429453, 19738412, 19875957, 19898422, 20067880, 20390341, 20484043, 20592103, 20604969, 20663982, 21105050, 21120602, 21122099, 21160418, 21392396, 21410323, 21435239, 21477609, 21492444, 21924251, 22105146, 22231442, 22271289, 22370157, 22451234, 22465878, 22792352, 22820289, 23064813, 23153457, 23158001, 23274843, 23374155, 23460808, 23588792, 23711151, 23752064, 23774759, 23954741, 24031087, 24068253, 24103091, 24192230, 24339738, 24355881, 24375531, 24376209, 24430361, 24525454, 24552459, 24785256, 24833090, 24960160, 25007965, 25305176, 25313140, 25341980, 25347741, 25728338, 25956916, 26100284, 26158518, 26232188, 26397740, 26590813, 26670079, 26709918, 26730581, 26863572, 26902609, 27179695, 27810901, 28332606, 28376210, 28454303, 28520140, 28577282, 28583190, 28673316, 28797712, 28808484, 28858267, 28975625, 29093337, 29096893, 29414691, 29509190, 29552303, 29854295, 29913427, 30257941, 30323891, 30338035, 30646517, 30687231, 30737644, 30990221, 31401293, 31412908, 31506431, 31575907, 31604073, 31656321, 31673032, 31749762, 8616779, 9443393		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17132221, 19434490, 19548127		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	16808847	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10623650, 11308260, 11574541, 11598948, 11676856, 11734621, 11959119, 12736255, 12750263, 14745018, 15113861, 15477868, 16118406, 16219765, 16554735, 16723304, 16880783, 17428314, 17457609, 17553133, 17617929, 17640362, 17889406, 17935138, 18258689, 18405391, 18483465, 18644836, 18752050, 18771580, 18784357, 18831727, 19298602, 19321582, 19340624, 19491296, 19491898, 19528477, 19638208, 19738412, 19882362, 19898422, 19940362, 20211987, 20332278, 20592103, 20604969, 20655613, 20696772, 20884965, 20974640, 21233487, 21235772, 21392396, 21410323, 21492444, 21924251, 22347418, 22370157, 22622808, 22792352, 23096432, 23374155, 23711151, 23774759, 23882126, 24047421, 24192230, 24289629, 24355881, 24430361, 24457087, 24525454, 24552459, 24618835, 24833090, 25242450, 25313140, 25363786, 25450264, 25956916, 26488768, 26590813, 26670079, 26968553, 26970359, 28003019, 28332606, 28577282, 28643774, 29017520, 29093337, 29509190, 30326857, 30669416, 30990221, 31506431, 31571071, 31575907, 32075687, 32160387, 32260128, 32321078, 32352194, 33050027, 33159119, 33512780, 34602561, 35011656, 35304506, 35573183, 35886868, 36835157, 37682272, 39742369	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	11517191, 16760287, 16808847, 21435239, 25027393, 26276747, 35872983	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24103091	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	23096432	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	9851804		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	24470591		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10835496, 11517191, 18021179, 19478391, 20920096, 21493669, 28681123, 36235125	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29017520, 37748565	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	15637090		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	20548329, 23923078, 26450901, 27848152		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	19493328	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26036714	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	29190668	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12879470, 17191310, 26804600, 27757837, 27899088, 29085224, 34787087, 35007301	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26006022	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	29654370	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22965848, 24148819, 26556868, 30459405, 31076571		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	30947969		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19106194, 20655613, 21546410, 22729568, 22985911, 24398390, 25338663, 25744245, 28915603, 29346580, 29970138, 30190703, 30216513, 30250297, 31651857		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	23096432		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	10960636, 18704709, 19331143, 23497172, 24376209, 32992652, 34071938	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19032364, 22970307	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23460808, 26587829, 30017803	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	16700038	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31575907		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	17639508		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	LHGDN	18459544		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	18931615, 29190668		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	17639508		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15313930, 18268123, 18704709, 19032364, 19331143, 21673961, 21695196, 22271292, 22970307, 24376209, 24378878, 24881814, 26861465, 28482871, 28654894, 29422491, 29535531, 29743815, 29783074, 30326857, 31077012, 31200086		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	15637090		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	29137284, 30519320		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	19200930	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	20605134	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37306894	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16522905, 17702854, 19938352, 22324545, 22906475, 23480168, 28119050, 28335423, 28625324		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	16766435		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	17702854, 19932075, 22324545, 25422593	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	22883423	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	29275294, 31280197		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	24319683		★☆☆☆☆ Found in Text Mining only
Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31676226		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22305517, 28625324, 31676226		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	22305517		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23923078, 30957588, 31507337		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	1672915		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23923078, 30957588, 31507337		★☆☆☆☆ Found in Text Mining only
Childhood Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19008315, 19117011, 22439007, 25885794, 28877739		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	21351254		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16936263	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20172949		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	17241382		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	31678865		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	27220899	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	17522255		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27866977		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27940297		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	27737359		★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	21874257		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	24662928		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	17889406, 23932494	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21252046, 30515752, 30590045		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26497217, 31261736	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10425218, 10753641, 11078914, 15944762, 15947116, 16830793, 19034156, 19602591, 20548329, 21161820, 21493669, 22398780, 22729816, 23143558, 23436804, 24531912, 25207387, 25683270, 26339386, 28285526, 28681123, 29122010		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15545229, 20548329, 23055188, 40076925	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15947116, 19034156		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21161820		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14716825, 19148895, 19602591, 19874446, 20446826, 20663982, 21317201, 21490239, 21493669, 21809392, 21884200, 22398780, 22729816, 22759347, 23143558, 23149914, 23585455, 23965904, 24531912, 25376484, 26339386, 26367493, 26503819, 26708506, 27207660, 28404976, 28681123, 28763692, 28889324, 29132333, 29137421, 29387989, 29441863, 29953268, 30515752, 30931802, 31182915, 31352466		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	15954165		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	14716825, 18727987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14716825, 19478391, 19785773, 20548329, 20680712, 22759347, 22836803, 23055188, 23143558, 23149914, 25376484, 25650184, 26503819, 28681123, 28889324, 29122010, 30931802, 31928047, 33859619, 34077003, 34898546, 36183698, 36901930, 37206439, 37443102, 37499109, 37748565, 40076925	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	15954165		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16309230	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19602591, 24531912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21493669, 26339386, 29132333, 36293473	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	23480168, 30376877		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23460808, 26585149, 26587829, 29490945, 29789714, 30017803, 30171816, 30271170		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15662019, 17941906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	20559769		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	15536156, 15662019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	16099331, 17941906, 19938352		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	17110088, 25973102, 34088265	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	20559769		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	25973102	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	CTD_human_DG	17367797		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	17941906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	26497217, 31261736	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30278183, 31261736		★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	16226111		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	28549035		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	11020519		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	17184825		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16098017, 21080949, 21523342, 23352710		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	23491264, 28789972		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	23491264	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	19473078, 22183267		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30679747		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21804148, 22901010, 24031087, 26169989, 28544903		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	34566951	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30628111		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30628111		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	17077595, 20305341, 23035734	Associate	★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	21351254		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	36235125	Associate	★☆☆☆☆ Found in Text Mining only
Developmental reading disorder	Developmental dyslexia	BEFREE	28241485		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36788175	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33902539	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30096284, 30447304		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23506158, 29618657, 30201537		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27357538, 29032728		★☆☆☆☆ Found in Text Mining only
Disorder of Sex Development 46 XY	46, xy disorder of sex development	Pubtator	29261182	Associate	★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	29261182	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22156442		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	22156442	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	23701402		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	12725419, 23701402		★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	39456258	Associate	★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	22383464	Associate	★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	28241485		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	16099331, 22460951		★☆☆☆☆ Found in Text Mining only
EMERY-DREIFUSS MUSCULAR DYSTROPHY 5, AUTOSOMAL DOMINANT	Emery-Dreifuss Muscular Dystrophy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	21492444, 26364046	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	23688837, 31357971		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11207052, 15280642, 19438492, 22378275, 23873111, 23974281, 25305176, 26745067, 29085506, 31357971, 31695408, 7746737		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	25437045		★☆☆☆☆ Found in Text Mining only
Endometrial Diseases	Endometrial Diseases	BEFREE	25305176		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	15882182, 26276747	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	16677694, 30745857		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11207052, 15579769, 15882182, 16884380, 17649817, 19758455, 21281625, 24338391, 24835059, 26036714, 26745067, 26930451, 31357971, 34510841, 36769338	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12873984, 14691461, 15170658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23873111	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	25437045		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrioma	Endometrioma	BEFREE	10381820, 11020519, 26394174		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	17625110		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15193490, 15618247, 16210018, 17336962, 17474167, 17625110, 17941906, 19878085, 20586553, 20857063, 21110202, 21269613, 21476192, 21958689, 22271293, 23177411, 24704270, 25257822, 26036904, 26899323, 27167072, 27272520, 29629944, 30018006, 30078406, 30411422, 30428773, 30684560, 30838396, 30965114, 31504401, 9701786		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	LHGDN	15193490, 16855153, 17474167, 17548071, 17625110, 18048499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	15193490, 16210018, 17336962, 17548071, 18048499, 19001520, 19878085, 20586553, 21476192, 21561608, 22520060, 24992181, 25029427, 26134036, 26827666, 27167072, 27323100, 29664547, 32606145, 33362719, 36788175, 37996888	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	17454161, 23749764	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	17625110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic esophagitis	Eosinophilia	BEFREE	30578870		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	30578870	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31608530		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	18704709, 19331143, 21695196, 22970307, 24376209		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22463081, 35645543	Associate	★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	26945007		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	ORPHANET_DG	26945007		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	30450159		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	16731592	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28092182		★☆☆☆☆ Found in Text Mining only
Fibrillary Astrocytoma	Fibrillary Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	16554735		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	LHGDN	16554735		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	11826769, 17646097, 19012097		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	19012097, 22377971, 26529545		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	30742303		★☆☆☆☆ Found in Text Mining only
Follicular Cyst	Follicular cyst	Pubtator	34068748	Associate	★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	23106428		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22808109		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	15492781		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	22808109, 32024900	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	17046193		★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	14555521		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	16859590, 31725654		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	16859590		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	18195227		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	18195227		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	20399928		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27869737, 29320480, 29629572, 29661831, 30992459, 31164645		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27869737, 29320480, 29629572, 29661831, 30992459, 31164645		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22442308, 23399685, 25351348, 29113424		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23399685	Associate	★☆☆☆☆ Found in Text Mining only
Grade I Astrocytoma	Grade I Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	LHGDN	15155785		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	29786517		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	11887032, 17941906, 20961965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	26578364		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	24625355		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	9824210		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28544903, 29481981		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29127073, 31752065		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30578870	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30376877		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30496125		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	18771580	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	21392396, 23768005, 25411358, 35886868	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16760287, 18957107, 22622808, 28225892, 30705367, 31357971	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21866462	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28052027		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	Pubtator	23612777	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	22460951, 31396159		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	19927160		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Secondary	Hyperparathyroidism	Pubtator	11204421	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	15882182	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	34566951	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	15894829, 28938457	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11185739, 11799247, 15894829, 16280269, 21199728, 27078860, 28189710, 30635990, 31682817, 31752065		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	16280269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Hypospadias	BEFREE	16553027, 17579196, 18375409, 20215396, 25463985, 27300571		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Hypospadias	LHGDN	16553027, 18375409		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Hypospadias	Pubtator	22341273, 32124842	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	20385358	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20569445, 37748565	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22482968, 23399685	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30515752		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	36788175	Stimulate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	17889406, 26307455, 30096284, 30201537, 31608530		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	21269226	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	23913373, 26400324	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15618247, 21252046, 27817132, 28573506, 31678865		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26497217	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30628111		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28472101	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
insulinoma	Insulinoma	BEFREE	18045959		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	17522255		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33660790	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Astrocytoma	Intracranial Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	21782536		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	LHGDN	16883534		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	22451234		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28774781		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	22305517, 26784014		★☆☆☆☆ Found in Text Mining only
Juvenile Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	16214508	Associate	★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Leigh syndrome	Pubtator	25692143	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	18166184, 19012097	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	27100507	Stimulate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Visceral	Visceral leishmaniasis	Pubtator	11384649	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21683083	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28835383		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	22011627		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	22011627, 30021121		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10579340, 12879470, 26804600, 27757837, 27899088, 29085224		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	36207725	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	26608979	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	12879470, 17191310, 26804600	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10579340		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	20399928		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	16214508, 21546410, 23619141, 25338663, 26678909, 31651857	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17638897, 19106194		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	21062926, 23619141, 24398390, 26678909		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20305046, 20961965, 29643853		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20604969, 29190668, 35573183	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21188569, 30705367	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24470591, 28052027, 30496125		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	29032728	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	17365134, 26169989, 27814959		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	17365134		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29700475, 30718901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	21430602		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	29113424		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	30496125		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	19487281		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	29048219		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10554009, 10554010, 10601611, 10690532, 10759732, 10763153, 11072241, 11162931, 11165756, 11818203, 12454770, 12846425, 12889601, 14517838, 14576822, 14633679, 14729654, 15325017, 15374639, 15477865, 15522549, 15536519, 15591034, 15604249, 15613450, 15867209, 16010412, 16118406, 16261413, 16322330, 16596234, 16615154, 16723304, 16728566, 16808847, 16951146, 17009105, 17095148, 17145865, 17428314, 17617929, 17638070, 17640362, 17876701, 17889406, 17904846, 17935138, 19082882, 19148525, 19298602, 19321582, 19429453, 19622517, 19738412, 19898422, 20067880, 20390341, 20484043, 20490651, 20592103, 20604969, 20663982, 21105050, 21120602, 21122099, 21160418, 21392396, 21410323, 21435239, 21477609, 21492444, 21924251, 22105146, 22231442, 22271289, 22370157, 22465878, 22792352, 22820289, 23064813, 23153457, 23158001, 23274843, 23374155, 23460808, 23588792, 23711151, 23752064, 23774759, 23954741, 23979844, 24031087, 24068253, 24103091, 24192230, 24339738, 24355881, 24375531, 24376209, 24430361, 24525454, 24552459, 24785256, 24833090, 24960160, 25007965, 25305176, 25313140, 25341980, 25347741, 25728338, 25956916, 26100284, 26158518, 26232188, 26397740, 26590813, 26670079, 26709918, 26730581, 26863572, 26902609, 27179695, 27810901, 28332606, 28376210, 28454303, 28520140, 28577282, 28583190, 28673316, 28692125, 28797712, 28808484, 28858267, 28975625, 29017520, 29093337, 29096893, 29414691, 29509190, 29552303, 29610818, 29854295, 29913427, 30257941, 30323891, 30338035, 30532556, 30646517, 30669416, 30687231, 30737644, 30990221, 31401293, 31412908, 31506431, 31571071, 31575907, 31604073, 31656321, 31673032, 31749762, 8616779, 9443393		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17132221, 19434490, 19548127		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11207052, 15280642, 19438492, 22378275, 23873111, 23974281, 25305176, 26745067, 29085506, 31357971, 31695408		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	22808109		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31695429		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11444848, 19106194, 20655613, 21546410, 22729568, 22985911, 24398390, 25338663, 25744245, 28915603, 29346580, 29970138, 30190703, 30216513, 30250297, 31651857		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15313930, 18268123, 21673961, 24376209, 24378878, 24881814, 26861465, 28225892, 28482871, 28654894, 29422491, 29535531, 29743815, 29783074, 30326857, 31041737, 31077012, 31200086		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11344205, 11438457, 11726203, 12497580, 15124082, 15161636, 15171712, 15958594, 16551880, 16921512, 17585029, 17908481, 17913855, 17932344, 17935138, 18006911, 18952763, 19189301, 19363294, 19654868, 20133657, 20615892, 20859991, 21487104, 21487105, 22114194, 22228197, 22403175, 22593181, 23060014, 23658372, 23658738, 23806560, 24038102, 24402043, 24837491, 24859835, 25611678, 25816367, 25818291, 25931004, 26251204, 26443449, 26450901, 26547439, 26575018, 26599461, 27889472, 27979317, 28147335, 28503095, 28796245, 28928821, 28968951, 29322786, 29360794, 29455003, 29610818, 29654831, 29963256, 30236540, 30326857, 30864712, 30979864		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15046698, 16220300, 16921512, 17132221, 17639508, 26443449		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	26168722		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20339947, 26503819, 31807000		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28643774, 30389909		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	16700038		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22965848, 24148819, 26556868, 28362839, 30459405, 31076571		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10554010, 11596023, 12051868, 12124830, 12829231, 15280642, 16317584, 16615154, 17046193, 18225578, 20920096, 21069581, 21487105, 22228197, 22378275, 22720981, 22759347, 23106428, 23143558, 23153457, 23399685, 23585455, 23865427, 23871935, 23979844, 24031087, 24148819, 24217507, 24618619, 24743148, 24960160, 25313140, 25611678, 25979597, 26367493, 26547439, 26599461, 27557932, 27816767, 27848152, 27869737, 27889472, 28003019, 28480526, 28796245, 28835383, 28861689, 29137421, 29210666, 29352049, 29490945, 29509190, 29552303, 29592953, 29661831, 30099673, 30272319, 30326857, 30389909, 30450159, 30555629, 31200086, 31310807, 31357971, 31523634		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21075781		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	22245602		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23923078, 30957588, 31507337		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10425218, 10753641, 11078914, 15944762, 15947116, 16830793, 19034156, 19602591, 20548329, 21161820, 21493669, 22398780, 22729816, 23143558, 23436804, 24531912, 25207387, 25683270, 26339386, 28285526, 28681123, 29122010		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17132221, 19434490, 19548127		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10554010, 10601611, 14576822, 15374639, 16880783, 21492444, 22105146, 22820289, 24192230, 24960160, 26709918, 27764788, 28673316, 28692125, 28808484, 29100336, 30687231		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12242035, 14576822, 14633679, 14715875, 14745018, 14973391, 15073120, 15208676, 15254780, 15355905, 15383631, 15723135, 16118406, 16261413, 16760287, 16791593, 16808847, 16951146, 17203178, 17415682, 17428314, 17604135, 17617929, 17640362, 17904846, 18216219, 18234277, 18669459, 18698041		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17132221, 19434490, 19548127		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17132221, 19434490, 19548127		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	24470591, 30496125		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17951536, 26945007		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19008315, 19117011, 22439007, 25885794, 28877739		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	CTD_human_DG	21351254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	22439007	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	21351254		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	29320480		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21734414, 24258993, 28549035, 29592953, 31696058		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	23812018, 26225426, 28643774, 34833446, 34990694, 36499700	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	21351254		★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	31608530		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	21804148, 22901010, 24031087, 26169989, 28544903		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29048219		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	21124760, 22011668, 27529370	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	18584035		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	16949391, 19032032, 22011627, 24037776, 30049354, 30217154		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	17013895, 29094395		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	19093296		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	19093296		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22311091		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	20716560, 26287523		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33362719	Associate	★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16210018, 26827666	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27771018, 29844175, 30679747, 30967304, 31226301, 31396345		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	29215066		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	29320918	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	28263188	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	28263188		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	LHGDN	15661863		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	15661863	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17702854, 18487282, 28810592, 28903498, 30036658		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17702854	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31551929		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	28586319		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10601611, 11078914, 11438457, 11726203, 12051868, 12152165, 12454770, 12497580, 14729654, 15536519, 15613450, 15867209, 15900599, 15947116, 16010412, 17046193, 17908481, 17913855, 17951536, 18165403, 18791324, 18931615, 19008315, 19434490, 19602591, 20074560, 20446826, 21088384, 21122099, 21124760, 21435239, 21487105, 21511357, 21809392, 22105146, 22271289, 22378275, 22398780, 22442308, 22451234, 22465878, 22720981, 22820289, 22851332, 22970307, 23024189, 23060014, 23153457, 23399685, 23460808, 23585455, 23619141, 23658372, 23871935, 23923078, 23979844, 24031087, 24103091, 24260416, 24470591, 24837491, 25007965, 25042571, 25269750, 25351348, 25408199, 25692143, 25885794, 25931004, 25956916, 25979597, 26168722, 26208479, 26339386, 26367493, 26582578, 26587829, 26599461, 26670079, 26708506, 26861465, 26945007, 27052470, 27234503, 27324053, 27357538, 27572263, 27597531, 27810901, 27848152, 27873496, 28052027, 28166815, 28362839, 28439009, 28445992, 28459202, 28654894, 28670368, 28705918, 28808484, 28927080, 29094395, 29096893, 29113424, 29122010, 29186712, 29228549, 29303935, 29322786, 29385707, 29509190, 29573619, 29661831, 29682196, 29854295, 29970138, 30013628, 30046904, 30257941, 30326857, 30450159, 30459405, 30655790, 30738018, 30864727, 30873822, 30979864, 30992459, 31288527, 31357971, 31604073, 31656321, 31695429, 31725654, 31792072, 6323162, 9730607, 9745446, 9824210		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23584859	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31495239		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24031087		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28241485		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	25058880		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16226111, 19460433, 20655613, 21511357, 21600232, 22583357, 22658344, 23129017, 24618619, 25310221, 25744245, 26096604, 26456481, 26678909, 27572263, 28454404, 28915603, 29117942, 29970138, 30022688, 30250297, 31288527, 31606604, 31651857		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	31604073		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28092182		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	12467029, 15867209, 17069663		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17509633, 18053221, 19111408, 19938352, 22460951, 22828941, 24173768, 25089907, 26709918, 27733447, 28680060, 30342056, 31811898		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18053221, 19111408, 26694100, 33902539, 35856485, 38003551	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35682668	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	38003551	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	18053221		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	20850223		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	12454770, 24618835, 24973581, 25531331		★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	26410888		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	16815861, 20131243, 39189559	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	23352710		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29794404		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	12137804, 16530497, 17889406, 17945165, 20508921, 28858267, 29030963, 29320918, 29458346, 30556843		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	LHGDN	16777502		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	17002564, 17889406, 24997336, 29320918, 29745905, 30556843	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	12137804, 16530497, 17945165, 29458346		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	15802376		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27127126, 29071206, 31383536, 31692529		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32054506	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	21673961		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	24704270		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	11384649	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	10856486, 17454161, 21207255, 23749764, 28482871, 29629944, 30728052, 31878927	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22970307	Inhibit	★☆☆☆☆ Found in Text Mining only
OVARIAN DYSGENESIS 8	Ovarian Dysgenesis	UNIPROT_DG	30113650		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ovarian Failure, Premature	Ovarian Failure	BEFREE	23150099, 30156935		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	28676533		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12969589, 18268123, 18704709		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15313930, 18165403, 18268123, 24376209, 24378878, 24881814, 26861465, 28482871, 28654894, 29422491, 29535531, 29743815, 29783074, 30326857, 31077012, 31200086		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11384649, 15141349, 18704709, 19032364, 19331143, 21673961, 23176303, 23497172, 24376209, 28225892, 28482871, 28859612, 30326857, 32705198, 32856599, 32992652, 34207568	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	25408199, 25655200		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	21963730	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30046904		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30373552	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	22936184, 24884830, 28124274, 28947799, 29655286, 30389909, 30705367		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15219649, 15635591, 20304699, 21951066, 22155094, 24595449, 24768803, 29266208		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	15219649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	20304699, 22155094	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	21951066	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	30061737		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	22038234		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	22038234, 37430099	Associate	★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	16553027, 17579196, 18375409, 20215396, 25463985, 27300571		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	28711487		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	21570196		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	16554735, 27056456		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	LHGDN	16554735		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	21632819		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	19185861, 22296324, 25603724, 30204276, 30745857, 31173821, 31360184		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	19185861, 30745857, 38281964	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21269226, 22296324, 25603724	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32482257	Stimulate	★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	26708506		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	26036718		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	23150099, 30156935		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	23491264, 28789972		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	26608979, 28013213		★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11344205, 11438457, 11596023, 12152165, 12497580, 15124082, 15147889, 15161636, 15171712, 15900599, 15958594, 16551880, 16921512, 17585029, 17908481, 17913855, 17932344, 17935138, 18006911, 18952763, 19189301, 19363294, 19654868, 20133657, 20615892, 20859991, 21487104, 21487105, 22114194, 22228197, 22403175, 22593181, 23060014, 23658372, 23658738, 23806560, 24038102, 24402043, 24837491, 24859835, 25611678, 25816367, 25818291, 25931004, 26251204, 26443449, 26450901, 26547439, 26575018, 26599461, 27889472, 28147335, 28503095, 28796245, 28928821, 28968951, 29322786, 29360794, 29455003, 29610818, 29654831, 29963256, 30236540, 30326857, 30864712, 30979864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	26443449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Diseases	Prostatic disease	Pubtator	25527409	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	27866977		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	28261681	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	33031138	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	CTD_human_DG	16220300		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12122114, 15161636, 16756716, 18007998, 18505969, 18625043, 19363294, 19654868, 20385358, 20501637, 22114194, 22403175, 22549291, 22593181, 23487784, 23658372, 23658738, 23744763, 23806560, 24555436, 24837491, 25219910, 25816367, 25931004, 26251204, 27610593, 28147335, 29206234, 30361641, 30864712, 32132580, 32235729, 32328032, 32413024, 33020300, 33451122, 36544211, 36960864, 37049632, 37279148, 39340410	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15046698, 16220300, 16921512, 17132221, 17639508, 26443449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15147889, 15171712, 16551880, 16921512, 17503469, 17585029, 17932344, 18007998, 18607069, 18952763		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15171712, 21487105, 23658372, 25816367, 26443449, 26450901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15958594, 21733187	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	28439009		★☆☆☆☆ Found in Text Mining only
Protoplasmic astrocytoma	Protoplasmic Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	25854761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychomotor Disorders	Psychiatric disorders	Pubtator	23932494	Associate	★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	21107812		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	23975835		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23460808, 26585149, 26587829, 29789714, 30017803, 30171816, 30271170		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	22970307		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	18451176		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19555469, 20349239, 21174621, 21523342, 22580535, 30174672		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	28344760		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	19878085	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	26168722, 29385707	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	14516317		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11807414, 18164902, 22001950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	11807414, 18164902, 22001950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis	Scoliosis	Pubtator	25410117, 33339862, 35627124	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	19493328	Inhibit	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	21381029, 22392906, 24451139, 28459202		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	22068818, 28459202	Associate	★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	21804148		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe depression	Mental Depression	PSYGENET_DG	21804148		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	30113650		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	18771580	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	16261413, 17457609, 17904846, 19429453, 22105146, 23794253, 24833090, 28109853		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24217507, 24743148, 26678909, 27688241		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22463081, 24101172, 28724213, 31725654		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19825947, 21205741, 28166815	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	28166815		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31611744		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21205741, 28166815		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20339947, 26503819, 31807000		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12073050, 23199240, 26503819, 27781410, 27893427, 28388558	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	39518968	Associate	★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Subfertility, Female	Subfertility	CTD_human_DG	23710174		★☆☆☆☆ Found in Text Mining only
Syringomyelia	Syringomyelia	BEFREE	29675990		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30496125		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	29621430		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	30296306		★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular Diseases	BEFREE	30825546		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	22402210		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	22068818	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	20372779, 22936184, 24114184, 24884830, 30705367	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35162942	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28643774, 30389909		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	24114184	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	23106428		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17951536		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30389909		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	20372779, 26261608, 28643774	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24114184	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	20067378	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	18771580, 22266872, 24833090, 25874233, 26871946, 26968553, 27133732, 28003019, 30990221, 31792072, 32260128, 32678032, 33001337, 33050027, 34665934, 35304506, 35843988, 36772966, 38105538	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22266872, 23979844, 25420519, 25874233, 26871946, 27848152, 28003019, 28376210, 28583190, 29100336, 29228549, 29552303, 29592953, 29610818, 30257941, 30323891, 30338035, 30615483, 30805773, 30873822, 30990221, 31563883, 31792072		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31261736		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	15637090		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	17365134		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	26169989, 27814959		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16700038, 22965848, 23612777, 25048477, 26090392, 27324053, 37668795	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	17963065	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	29769420	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	27052470, 27635763	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	27052470		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23923078	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	10835496, 20605134	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	19012097, 19639498, 19715484, 22377971, 26529545, 26715264, 9824210		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	17272673	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	17540666		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	29680290	Inhibit	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	23932494	Associate	★☆☆☆☆ Found in Text Mining only