ESR1 (estrogen receptor 1)

Gene

• Entrez ID: 2099
• Gene name: Estrogen receptor 1
• Gene symbol: ESR1
• Synonyms (NCBI Gene): ER, ESR, ESRA, ESTRR, Era, NR3A1
• Chromosome: 6
• Chromosome location: 6q25.1-q25.2
• Summary: This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent trans

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893956	C>T	Pathogenic	Intron variant, non coding transcript variant, coding sequence variant, stop gained, genic upstream transcript variant, 5 prime UTR variant
rs121913043	TG>GC	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs397509428	G>T	Pathogenic	Missense variant, coding sequence variant, intron variant
rs796065354	A>G	Risk-factor	Non coding transcript variant, missense variant, coding sequence variant
rs1057519714	T>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant, intron variant, genic downstream transcript variant
rs1057519715	T>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant, 3 prime UTR variant, intron variant, genic downstream transcript variant
rs1057519716	C>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant, 3 prime UTR variant, intron variant, genic downstream transcript variant
rs1057519717	T>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant, 3 prime UTR variant, intron variant, genic downstream transcript variant
rs1057519827	G>C	Likely-pathogenic	Intron variant, coding sequence variant, missense variant
rs1131692059	G>A	Pathogenic-likely-pathogenic	Intron variant, coding sequence variant, missense variant
rs1562787582	T>A	Risk-factor	Genic downstream transcript variant, 3 prime UTR variant, non coding transcript variant, intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002474	hsa-miR-22-3p	Western blot	18347104
MIRT000700	hsa-miR-206	qRT-PCR	18593897
MIRT000703	hsa-miR-18a-5p	Western blot	19706389
MIRT004308	hsa-miR-29b-3p	Western blot	19706389
MIRT004309	hsa-miR-19b-3p	Western blot	19706389
MIRT000703	hsa-miR-18a-5p	qRT-PCR	19706389
MIRT000703	hsa-miR-18a-5p	Western blot	19706389
MIRT004309	hsa-miR-19b-3p	qRT-PCR	19706389
MIRT004309	hsa-miR-19b-3p	Western blot	19706389
MIRT004313	hsa-miR-20b-5p	Western blot	19706389
MIRT004313	hsa-miR-20b-5p	qRT-PCR	19706389
MIRT004313	hsa-miR-20b-5p	Luciferase reporter assay	19706389
MIRT004309	hsa-miR-19b-3p	Luciferase reporter assay	19706389
MIRT000703	hsa-miR-18a-5p	Luciferase reporter assay	19706389
MIRT000703	hsa-miR-18a-5p	Luciferase reporter assay, Microarray	19684618
MIRT000702	hsa-miR-18b-5p	Luciferase reporter assay, Microarray	19684618
MIRT000701	hsa-miR-193b-3p	Luciferase reporter assay, Microarray	19684618
MIRT000700	hsa-miR-206	Luciferase reporter assay, Microarray	19684618
MIRT000699	hsa-miR-302c-3p	Luciferase reporter assay, Microarray	19684618
MIRT000699	hsa-miR-302c-3p	Luciferase reporter assay, Microarray	19684618
MIRT000699	hsa-miR-302c-3p	Luciferase reporter assay, Microarray	19684618
MIRT002474	hsa-miR-22-3p	Luciferase reporter assay	19414598
MIRT000703	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20080637
MIRT000703	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20080637
MIRT000703	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20080637
MIRT000703	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20080637
MIRT003214	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	20080637
MIRT005320	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	18790736
MIRT005320	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	18790736
MIRT005320	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	18790736
MIRT005320	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	18790736
MIRT005321	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	18790736
MIRT005321	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	18790736
MIRT005321	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	18790736
MIRT005321	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	18790736
MIRT000700	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Western blot	17312270
MIRT000700	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Western blot	17312270
MIRT000700	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Western blot	17312270
MIRT000700	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Western blot	17312270
MIRT000700	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Western blot	17312270
MIRT000700	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Western blot	17312270
MIRT000700	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Western blot	17312270
MIRT000700	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Western blot	17312270
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT002474	hsa-miR-22-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT000700	hsa-miR-206	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT000700	hsa-miR-206	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT000700	hsa-miR-206	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT000700	hsa-miR-206	Immunoblot, Luciferase reporter assay, qRT-PCR	19414598
MIRT006356	hsa-miR-130a-3p	GFP reporter assay	21712254
MIRT006356	hsa-miR-130a-3p	GFP reporter assay	21712254
MIRT006389	hsa-miR-26a-5p	Luciferase reporter assay	21610700
MIRT006389	hsa-miR-26a-5p	Luciferase reporter assay	21610700
MIRT006356	hsa-miR-130a-3p	GFP reporter assay	21712254
MIRT006356	hsa-miR-130a-3p	GFP reporter assay	21712254
MIRT006389	hsa-miR-26a-5p	Luciferase reporter assay	21610700
MIRT006389	hsa-miR-26a-5p	Luciferase reporter assay	21610700
MIRT006356	hsa-miR-130a-3p	GFP reporter assay	21712254
MIRT006356	hsa-miR-130a-3p	GFP reporter assay	21712254
MIRT006389	hsa-miR-26a-5p	Luciferase reporter assay	21610700
MIRT006389	hsa-miR-26a-5p	Luciferase reporter assay	21610700
MIRT006774	hsa-miR-145-5p	Luciferase reporter assay	19730444
MIRT006774	hsa-miR-145-5p	Luciferase reporter assay	19730444
MIRT006774	hsa-miR-145-5p	Luciferase reporter assay	19730444
MIRT006774	hsa-miR-145-5p	Luciferase reporter assay	19730444
MIRT000700	hsa-miR-206	Western blot;qRT-PCR	17312270
MIRT005321	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	24498137
MIRT437957	hsa-miR-100-5p	qRT-PCR	24711889
MIRT437957	hsa-miR-100-5p	qRT-PCR	24711889
MIRT617884	hsa-miR-548ac	HITS-CLIP	23824327
MIRT617883	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT617882	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT617881	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT617880	hsa-miR-548z	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT658526	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT658525	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT658524	hsa-miR-4797-3p	HITS-CLIP	23824327
MIRT658523	hsa-miR-4264	HITS-CLIP	23824327
MIRT658522	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT658521	hsa-miR-7855-5p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT617884	hsa-miR-548ac	HITS-CLIP	23824327
MIRT617883	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT617882	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT617881	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT617880	hsa-miR-548z	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT617879	hsa-miR-519a-3p	HITS-CLIP	23824327
MIRT617878	hsa-miR-519b-3p	HITS-CLIP	23824327
MIRT617877	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT617876	hsa-miR-302a-3p	HITS-CLIP	23824327
MIRT617875	hsa-miR-302b-3p	HITS-CLIP	23824327
MIRT000699	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT617874	hsa-miR-302d-3p	HITS-CLIP	23824327
MIRT617873	hsa-miR-302e	HITS-CLIP	23824327
MIRT617872	hsa-miR-372-3p	HITS-CLIP	23824327
MIRT617871	hsa-miR-373-3p	HITS-CLIP	23824327
MIRT617870	hsa-miR-520a-3p	HITS-CLIP	23824327
MIRT617869	hsa-miR-520b	HITS-CLIP	23824327
MIRT617868	hsa-miR-520c-3p	HITS-CLIP	23824327
MIRT617867	hsa-miR-520d-3p	HITS-CLIP	23824327
MIRT617866	hsa-miR-520e	HITS-CLIP	23824327
MIRT617865	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT502521	hsa-miR-4295	PAR-CLIP	24398324
MIRT502522	hsa-miR-3666	PAR-CLIP	24398324
MIRT502520	hsa-miR-301b-3p	PAR-CLIP	24398324
MIRT502519	hsa-miR-301a-3p	PAR-CLIP	24398324
MIRT502518	hsa-miR-130b-3p	PAR-CLIP	24398324
MIRT006356	hsa-miR-130a-3p	PAR-CLIP	24398324
MIRT502517	hsa-miR-454-3p	PAR-CLIP	24398324
MIRT502516	hsa-miR-548e-5p	PAR-CLIP	24398324
MIRT502515	hsa-miR-4422	PAR-CLIP	24398324
MIRT502514	hsa-miR-6757-3p	PAR-CLIP	24398324
MIRT238930	hsa-miR-3668	PAR-CLIP	24398324
MIRT238933	hsa-miR-7852-3p	PAR-CLIP	24398324
MIRT502513	hsa-miR-6073	PAR-CLIP	24398324
MIRT502512	hsa-miR-142-3p	PAR-CLIP	24398324
MIRT238931	hsa-miR-4671-3p	PAR-CLIP	24398324
MIRT238932	hsa-miR-4709-3p	PAR-CLIP	24398324
MIRT000703	hsa-miR-18a-5p	In situ hybridization, Next Generation Sequencing (NGS), qRT-PCR	26233958
MIRT731832	hsa-miR-26b-3p	Luciferase reporter assay	26723394
MIRT731832	hsa-miR-26b-3p	Luciferase reporter assay	26723394
MIRT005320	hsa-miR-221-3p	Luciferase reporter assay	26236014
MIRT005320	hsa-miR-221-3p	Luciferase reporter assay	26236014
MIRT735059	hsa-miR-4463	Western blotting, Microarray, qRT-PCR, ELISA	32854459
MIRT735576	ssc-miR-671-5p	Luciferase reporter assay, qRT-PCR	32138165
MIRT736123	hsa-miR-361-3p	RNA-seq	31688986
MIRT658522	hsa-miR-9-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33106914
MIRT617884	hsa-miR-548ac	HITS-CLIP	23824327
MIRT617883	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT617882	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT617881	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT617880	hsa-miR-548z	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT658526	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT658525	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT658524	hsa-miR-4797-3p	HITS-CLIP	23824327
MIRT658523	hsa-miR-4264	HITS-CLIP	23824327
MIRT658522	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT658521	hsa-miR-7855-5p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT617884	hsa-miR-548ac	HITS-CLIP	23824327
MIRT617883	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT617882	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT617881	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT617880	hsa-miR-548z	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT617879	hsa-miR-519a-3p	HITS-CLIP	23824327
MIRT617878	hsa-miR-519b-3p	HITS-CLIP	23824327
MIRT617877	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT617876	hsa-miR-302a-3p	HITS-CLIP	23824327
MIRT617875	hsa-miR-302b-3p	HITS-CLIP	23824327
MIRT000699	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT617874	hsa-miR-302d-3p	HITS-CLIP	23824327
MIRT617873	hsa-miR-302e	HITS-CLIP	23824327
MIRT617872	hsa-miR-372-3p	HITS-CLIP	23824327
MIRT617871	hsa-miR-373-3p	HITS-CLIP	23824327
MIRT617870	hsa-miR-520a-3p	HITS-CLIP	23824327
MIRT617869	hsa-miR-520b	HITS-CLIP	23824327
MIRT617868	hsa-miR-520c-3p	HITS-CLIP	23824327
MIRT617867	hsa-miR-520d-3p	HITS-CLIP	23824327
MIRT617866	hsa-miR-520e	HITS-CLIP	23824327
MIRT617865	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT613109	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT613108	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT613107	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT613106	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT613105	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT613104	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT613103	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT613102	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT613101	hsa-miR-4290	HITS-CLIP	23824327
MIRT613100	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT613099	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT613098	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT502521	hsa-miR-4295	PAR-CLIP	24398324
MIRT502522	hsa-miR-3666	PAR-CLIP	24398324
MIRT502520	hsa-miR-301b-3p	PAR-CLIP	24398324
MIRT502519	hsa-miR-301a-3p	PAR-CLIP	24398324
MIRT502518	hsa-miR-130b-3p	PAR-CLIP	24398324
MIRT006356	hsa-miR-130a-3p	PAR-CLIP	24398324
MIRT502517	hsa-miR-454-3p	PAR-CLIP	24398324
MIRT502516	hsa-miR-548e-5p	PAR-CLIP	24398324
MIRT502515	hsa-miR-4422	PAR-CLIP	24398324
MIRT502514	hsa-miR-6757-3p	PAR-CLIP	24398324
MIRT238930	hsa-miR-3668	PAR-CLIP	24398324
MIRT238933	hsa-miR-7852-3p	PAR-CLIP	24398324
MIRT502513	hsa-miR-6073	PAR-CLIP	24398324
MIRT502512	hsa-miR-142-3p	PAR-CLIP	24398324
MIRT238931	hsa-miR-4671-3p	PAR-CLIP	24398324
MIRT238932	hsa-miR-4709-3p	PAR-CLIP	24398324
MIRT755418	hsa-miR-4728-3p	Luciferase reporter assay, Western blotting	35655761
MIRT970331	hsa-miR-1207-3p	CLIP-seq
MIRT970332	hsa-miR-1226	CLIP-seq
MIRT970333	hsa-miR-1227	CLIP-seq
MIRT970334	hsa-miR-1231	CLIP-seq
MIRT970335	hsa-miR-1257	CLIP-seq
MIRT970336	hsa-miR-1266	CLIP-seq
MIRT970337	hsa-miR-1273c	CLIP-seq
MIRT970338	hsa-miR-1302	CLIP-seq
MIRT970339	hsa-miR-1321	CLIP-seq
MIRT970340	hsa-miR-139-5p	CLIP-seq
MIRT970341	hsa-miR-181a	CLIP-seq
MIRT970342	hsa-miR-181b	CLIP-seq
MIRT970343	hsa-miR-181c	CLIP-seq
MIRT970344	hsa-miR-181d	CLIP-seq
MIRT970345	hsa-miR-188-5p	CLIP-seq
MIRT970346	hsa-miR-1910	CLIP-seq
MIRT970347	hsa-miR-194	CLIP-seq
MIRT970348	hsa-miR-204	CLIP-seq
MIRT970349	hsa-miR-211	CLIP-seq
MIRT970350	hsa-miR-22	CLIP-seq
MIRT970351	hsa-miR-221	CLIP-seq
MIRT970352	hsa-miR-222	CLIP-seq
MIRT970353	hsa-miR-2277-3p	CLIP-seq
MIRT970354	hsa-miR-302a	CLIP-seq
MIRT970355	hsa-miR-302b	CLIP-seq
MIRT970356	hsa-miR-302c	CLIP-seq
MIRT970357	hsa-miR-302d	CLIP-seq
MIRT970358	hsa-miR-3119	CLIP-seq
MIRT970359	hsa-miR-3120-3p	CLIP-seq
MIRT970360	hsa-miR-3129-3p	CLIP-seq
MIRT970361	hsa-miR-3133	CLIP-seq
MIRT970362	hsa-miR-3145-3p	CLIP-seq
MIRT970363	hsa-miR-3153	CLIP-seq
MIRT970364	hsa-miR-3162-5p	CLIP-seq
MIRT970365	hsa-miR-3163	CLIP-seq
MIRT970366	hsa-miR-3187-3p	CLIP-seq
MIRT970367	hsa-miR-338-5p	CLIP-seq
MIRT970368	hsa-miR-3611	CLIP-seq
MIRT970369	hsa-miR-3613-3p	CLIP-seq
MIRT970370	hsa-miR-3614-3p	CLIP-seq
MIRT970371	hsa-miR-3618	CLIP-seq
MIRT970372	hsa-miR-3646	CLIP-seq
MIRT970373	hsa-miR-3654	CLIP-seq
MIRT970374	hsa-miR-3664-3p	CLIP-seq
MIRT970375	hsa-miR-3664-5p	CLIP-seq
MIRT970376	hsa-miR-3673	CLIP-seq
MIRT970377	hsa-miR-3677-5p	CLIP-seq
MIRT970378	hsa-miR-3683	CLIP-seq
MIRT970379	hsa-miR-372	CLIP-seq
MIRT970380	hsa-miR-373	CLIP-seq
MIRT970381	hsa-miR-380	CLIP-seq
MIRT970382	hsa-miR-3908	CLIP-seq
MIRT970383	hsa-miR-3914	CLIP-seq
MIRT970384	hsa-miR-3936	CLIP-seq
MIRT970385	hsa-miR-3945	CLIP-seq
MIRT970386	hsa-miR-4252	CLIP-seq
MIRT970387	hsa-miR-4262	CLIP-seq
MIRT970388	hsa-miR-4269	CLIP-seq
MIRT970389	hsa-miR-4288	CLIP-seq
MIRT970390	hsa-miR-4293	CLIP-seq
MIRT970391	hsa-miR-4298	CLIP-seq
MIRT970392	hsa-miR-4311	CLIP-seq
MIRT970393	hsa-miR-4325	CLIP-seq
MIRT970394	hsa-miR-4436b-5p	CLIP-seq
MIRT970395	hsa-miR-4477b	CLIP-seq
MIRT970396	hsa-miR-4504	CLIP-seq
MIRT970397	hsa-miR-4514	CLIP-seq
MIRT970398	hsa-miR-4518	CLIP-seq
MIRT970399	hsa-miR-451b	CLIP-seq
MIRT970400	hsa-miR-4529-5p	CLIP-seq
MIRT970401	hsa-miR-4533	CLIP-seq
MIRT970402	hsa-miR-455-3p	CLIP-seq
MIRT970403	hsa-miR-455-5p	CLIP-seq
MIRT970404	hsa-miR-4638-3p	CLIP-seq
MIRT970405	hsa-miR-4646-3p	CLIP-seq
MIRT970406	hsa-miR-4676-5p	CLIP-seq
MIRT970407	hsa-miR-4681	CLIP-seq
MIRT970408	hsa-miR-4687-3p	CLIP-seq
MIRT970409	hsa-miR-4692	CLIP-seq
MIRT970410	hsa-miR-4705	CLIP-seq
MIRT970411	hsa-miR-4711-3p	CLIP-seq
MIRT970412	hsa-miR-4714-5p	CLIP-seq
MIRT970413	hsa-miR-4716-3p	CLIP-seq
MIRT970414	hsa-miR-4733-3p	CLIP-seq
MIRT970415	hsa-miR-4739	CLIP-seq
MIRT970416	hsa-miR-4742-5p	CLIP-seq
MIRT970417	hsa-miR-4747-5p	CLIP-seq
MIRT970418	hsa-miR-4756-5p	CLIP-seq
MIRT970419	hsa-miR-4761-3p	CLIP-seq
MIRT970420	hsa-miR-4762-5p	CLIP-seq
MIRT970421	hsa-miR-4781-3p	CLIP-seq
MIRT970422	hsa-miR-4793-3p	CLIP-seq
MIRT970423	hsa-miR-4803	CLIP-seq
MIRT970424	hsa-miR-518a-5p	CLIP-seq
MIRT970425	hsa-miR-519a	CLIP-seq
MIRT970426	hsa-miR-520d-5p	CLIP-seq
MIRT970427	hsa-miR-524-5p	CLIP-seq
MIRT970428	hsa-miR-527	CLIP-seq
MIRT970429	hsa-miR-542-3p	CLIP-seq
MIRT970430	hsa-miR-548ae	CLIP-seq
MIRT970431	hsa-miR-548aj	CLIP-seq
MIRT970432	hsa-miR-548am	CLIP-seq
MIRT970433	hsa-miR-548b-3p	CLIP-seq
MIRT970434	hsa-miR-548c-3p	CLIP-seq
MIRT970435	hsa-miR-548p	CLIP-seq
MIRT970436	hsa-miR-548u	CLIP-seq
MIRT970437	hsa-miR-548v	CLIP-seq
MIRT970438	hsa-miR-548x	CLIP-seq
MIRT970439	hsa-miR-568	CLIP-seq
MIRT970440	hsa-miR-575	CLIP-seq
MIRT970441	hsa-miR-576-3p	CLIP-seq
MIRT970442	hsa-miR-582-3p	CLIP-seq
MIRT970443	hsa-miR-586	CLIP-seq
MIRT970444	hsa-miR-607	CLIP-seq
MIRT970445	hsa-miR-625	CLIP-seq
MIRT970446	hsa-miR-626	CLIP-seq
MIRT970447	hsa-miR-632	CLIP-seq
MIRT970448	hsa-miR-633	CLIP-seq
MIRT970449	hsa-miR-646	CLIP-seq
MIRT970450	hsa-miR-647	CLIP-seq
MIRT970451	hsa-miR-656	CLIP-seq
MIRT970452	hsa-miR-660	CLIP-seq
MIRT970453	hsa-miR-767-3p	CLIP-seq
MIRT970454	hsa-miR-802	CLIP-seq
MIRT970455	hsa-miR-873	CLIP-seq
MIRT970456	hsa-miR-874	CLIP-seq
MIRT970457	hsa-miR-9	CLIP-seq
MIRT970458	hsa-miR-934	CLIP-seq
MIRT970459	hsa-miR-103a	CLIP-seq
MIRT970460	hsa-miR-105	CLIP-seq
MIRT970461	hsa-miR-106a	CLIP-seq
MIRT970462	hsa-miR-106b	CLIP-seq
MIRT970463	hsa-miR-107	CLIP-seq
MIRT970464	hsa-miR-1184	CLIP-seq
MIRT970465	hsa-miR-1205	CLIP-seq
MIRT970331	hsa-miR-1207-3p	CLIP-seq
MIRT970466	hsa-miR-1207-5p	CLIP-seq
MIRT970467	hsa-miR-1225-3p	CLIP-seq
MIRT970332	hsa-miR-1226	CLIP-seq
MIRT970334	hsa-miR-1231	CLIP-seq
MIRT970468	hsa-miR-1233	CLIP-seq
MIRT970469	hsa-miR-124	CLIP-seq
MIRT970470	hsa-miR-1245	CLIP-seq
MIRT970471	hsa-miR-1252	CLIP-seq
MIRT970472	hsa-miR-1256	CLIP-seq
MIRT970335	hsa-miR-1257	CLIP-seq
MIRT970336	hsa-miR-1266	CLIP-seq
MIRT970473	hsa-miR-1271	CLIP-seq
MIRT970337	hsa-miR-1273c	CLIP-seq
MIRT970474	hsa-miR-1273d	CLIP-seq
MIRT970475	hsa-miR-1283	CLIP-seq
MIRT970476	hsa-miR-1287	CLIP-seq
MIRT970477	hsa-miR-1292	CLIP-seq
MIRT970478	hsa-miR-1297	CLIP-seq
MIRT970338	hsa-miR-1302	CLIP-seq
MIRT970479	hsa-miR-1305	CLIP-seq
MIRT970480	hsa-miR-130a	CLIP-seq
MIRT970481	hsa-miR-130b	CLIP-seq
MIRT970339	hsa-miR-1321	CLIP-seq
MIRT970482	hsa-miR-135a	CLIP-seq
MIRT970483	hsa-miR-135b	CLIP-seq
MIRT970484	hsa-miR-136	CLIP-seq
MIRT970485	hsa-miR-145	CLIP-seq
MIRT970486	hsa-miR-146a	CLIP-seq
MIRT970487	hsa-miR-146b-3p	CLIP-seq
MIRT970488	hsa-miR-146b-5p	CLIP-seq
MIRT970489	hsa-miR-151-3p	CLIP-seq
MIRT970490	hsa-miR-17	CLIP-seq
MIRT970341	hsa-miR-181a	CLIP-seq
MIRT970342	hsa-miR-181b	CLIP-seq
MIRT970343	hsa-miR-181c	CLIP-seq
MIRT970344	hsa-miR-181d	CLIP-seq
MIRT970491	hsa-miR-182	CLIP-seq
MIRT970492	hsa-miR-1827	CLIP-seq
MIRT970345	hsa-miR-188-5p	CLIP-seq
MIRT970493	hsa-miR-18a	CLIP-seq
MIRT970494	hsa-miR-18b	CLIP-seq
MIRT970495	hsa-miR-190	CLIP-seq
MIRT970496	hsa-miR-1908	CLIP-seq
MIRT970497	hsa-miR-1909	CLIP-seq
MIRT970498	hsa-miR-190b	CLIP-seq
MIRT970499	hsa-miR-1912	CLIP-seq
MIRT970500	hsa-miR-1913	CLIP-seq
MIRT970501	hsa-miR-192	CLIP-seq
MIRT970502	hsa-miR-193a-5p	CLIP-seq
MIRT970503	hsa-miR-19a	CLIP-seq
MIRT970504	hsa-miR-19b	CLIP-seq
MIRT970505	hsa-miR-203	CLIP-seq
MIRT970506	hsa-miR-2053	CLIP-seq
MIRT970507	hsa-miR-20a	CLIP-seq
MIRT970508	hsa-miR-20b	CLIP-seq
MIRT970509	hsa-miR-21	CLIP-seq
MIRT970510	hsa-miR-2114	CLIP-seq
MIRT970511	hsa-miR-2117	CLIP-seq
MIRT970512	hsa-miR-215	CLIP-seq
MIRT970513	hsa-miR-218	CLIP-seq
MIRT970514	hsa-miR-219-5p	CLIP-seq
MIRT970350	hsa-miR-22	CLIP-seq
MIRT970351	hsa-miR-221	CLIP-seq
MIRT970352	hsa-miR-222	CLIP-seq
MIRT970515	hsa-miR-2276	CLIP-seq
MIRT970353	hsa-miR-2277-3p	CLIP-seq
MIRT970516	hsa-miR-2355-5p	CLIP-seq
MIRT970517	hsa-miR-26a	CLIP-seq
MIRT970518	hsa-miR-26b	CLIP-seq
MIRT970519	hsa-miR-296-3p	CLIP-seq
MIRT970520	hsa-miR-299-5p	CLIP-seq
MIRT970521	hsa-miR-300	CLIP-seq
MIRT970522	hsa-miR-301a	CLIP-seq
MIRT970523	hsa-miR-301b	CLIP-seq
MIRT970354	hsa-miR-302a	CLIP-seq
MIRT970355	hsa-miR-302b	CLIP-seq
MIRT970356	hsa-miR-302c	CLIP-seq
MIRT970357	hsa-miR-302d	CLIP-seq
MIRT970524	hsa-miR-3065-3p	CLIP-seq
MIRT970525	hsa-miR-3065-5p	CLIP-seq
MIRT970358	hsa-miR-3119	CLIP-seq
MIRT970359	hsa-miR-3120-3p	CLIP-seq
MIRT970526	hsa-miR-3125	CLIP-seq
MIRT970527	hsa-miR-3127-5p	CLIP-seq
MIRT970360	hsa-miR-3129-3p	CLIP-seq
MIRT970528	hsa-miR-3130-5p	CLIP-seq
MIRT970361	hsa-miR-3133	CLIP-seq
MIRT970529	hsa-miR-3140-5p	CLIP-seq
MIRT970530	hsa-miR-3152-3p	CLIP-seq
MIRT970363	hsa-miR-3153	CLIP-seq
MIRT970531	hsa-miR-3156-5p	CLIP-seq
MIRT970532	hsa-miR-3157-5p	CLIP-seq
MIRT970533	hsa-miR-3158-5p	CLIP-seq
MIRT970534	hsa-miR-3160-3p	CLIP-seq
MIRT970364	hsa-miR-3162-5p	CLIP-seq
MIRT970365	hsa-miR-3163	CLIP-seq
MIRT970535	hsa-miR-3173-5p	CLIP-seq
MIRT970536	hsa-miR-3180	CLIP-seq
MIRT970537	hsa-miR-3180-3p	CLIP-seq
MIRT970538	hsa-miR-3183	CLIP-seq
MIRT970366	hsa-miR-3187-3p	CLIP-seq
MIRT970539	hsa-miR-3189-3p	CLIP-seq
MIRT970540	hsa-miR-3196	CLIP-seq
MIRT970541	hsa-miR-3200-5p	CLIP-seq
MIRT970542	hsa-miR-320a	CLIP-seq
MIRT970543	hsa-miR-320b	CLIP-seq
MIRT970544	hsa-miR-320c	CLIP-seq
MIRT970545	hsa-miR-320d	CLIP-seq
MIRT970546	hsa-miR-323-3p	CLIP-seq
MIRT970547	hsa-miR-323b-3p	CLIP-seq
MIRT970548	hsa-miR-324-3p	CLIP-seq
MIRT970549	hsa-miR-324-5p	CLIP-seq
MIRT970550	hsa-miR-330-3p	CLIP-seq
MIRT970367	hsa-miR-338-5p	CLIP-seq
MIRT970551	hsa-miR-33a	CLIP-seq
MIRT970552	hsa-miR-33b	CLIP-seq
MIRT970553	hsa-miR-34b	CLIP-seq
MIRT970554	hsa-miR-3606	CLIP-seq
MIRT970368	hsa-miR-3611	CLIP-seq
MIRT970555	hsa-miR-3612	CLIP-seq
MIRT970556	hsa-miR-361-5p	CLIP-seq
MIRT970557	hsa-miR-3617	CLIP-seq
MIRT970371	hsa-miR-3618	CLIP-seq
MIRT970558	hsa-miR-3622a-3p	CLIP-seq
MIRT970559	hsa-miR-3622b-3p	CLIP-seq
MIRT970560	hsa-miR-3622b-5p	CLIP-seq
MIRT970372	hsa-miR-3646	CLIP-seq
MIRT970561	hsa-miR-3653	CLIP-seq
MIRT970373	hsa-miR-3654	CLIP-seq
MIRT970562	hsa-miR-3658	CLIP-seq
MIRT970374	hsa-miR-3664-3p	CLIP-seq
MIRT970563	hsa-miR-3671	CLIP-seq
MIRT970377	hsa-miR-3677-5p	CLIP-seq
MIRT970378	hsa-miR-3683	CLIP-seq
MIRT970564	hsa-miR-3685	CLIP-seq
MIRT970565	hsa-miR-3691-3p	CLIP-seq
MIRT970566	hsa-miR-3691-5p	CLIP-seq
MIRT970567	hsa-miR-369-3p	CLIP-seq
MIRT970568	hsa-miR-3714	CLIP-seq
MIRT970569	hsa-miR-371b-5p	CLIP-seq
MIRT970379	hsa-miR-372	CLIP-seq
MIRT970380	hsa-miR-373	CLIP-seq
MIRT970570	hsa-miR-374a	CLIP-seq
MIRT970571	hsa-miR-374b	CLIP-seq
MIRT970572	hsa-miR-375	CLIP-seq
MIRT970381	hsa-miR-380	CLIP-seq
MIRT970573	hsa-miR-381	CLIP-seq
MIRT970574	hsa-miR-3907	CLIP-seq
MIRT970382	hsa-miR-3908	CLIP-seq
MIRT970575	hsa-miR-3910	CLIP-seq
MIRT970576	hsa-miR-3913-3p	CLIP-seq
MIRT970577	hsa-miR-3916	CLIP-seq
MIRT970578	hsa-miR-3925-3p	CLIP-seq
MIRT970579	hsa-miR-3925-5p	CLIP-seq
MIRT970384	hsa-miR-3936	CLIP-seq
MIRT970385	hsa-miR-3945	CLIP-seq
MIRT970580	hsa-miR-3973	CLIP-seq
MIRT970581	hsa-miR-3974	CLIP-seq
MIRT970582	hsa-miR-410	CLIP-seq
MIRT970583	hsa-miR-4257	CLIP-seq
MIRT970387	hsa-miR-4262	CLIP-seq
MIRT970388	hsa-miR-4269	CLIP-seq
MIRT970584	hsa-miR-4271	CLIP-seq
MIRT970585	hsa-miR-4273	CLIP-seq
MIRT970586	hsa-miR-4275	CLIP-seq
MIRT970587	hsa-miR-4276	CLIP-seq
MIRT970588	hsa-miR-4278	CLIP-seq
MIRT970589	hsa-miR-4282	CLIP-seq
MIRT970590	hsa-miR-4286	CLIP-seq
MIRT970389	hsa-miR-4288	CLIP-seq
MIRT970591	hsa-miR-4291	CLIP-seq
MIRT970391	hsa-miR-4298	CLIP-seq
MIRT970592	hsa-miR-4302	CLIP-seq
MIRT970593	hsa-miR-4303	CLIP-seq
MIRT970594	hsa-miR-4310	CLIP-seq
MIRT970392	hsa-miR-4311	CLIP-seq
MIRT970595	hsa-miR-4317	CLIP-seq
MIRT970596	hsa-miR-4318	CLIP-seq
MIRT970597	hsa-miR-4320	CLIP-seq
MIRT970598	hsa-miR-4323	CLIP-seq
MIRT970393	hsa-miR-4325	CLIP-seq
MIRT970599	hsa-miR-4326	CLIP-seq
MIRT970600	hsa-miR-4423-3p	CLIP-seq
MIRT970601	hsa-miR-4427	CLIP-seq
MIRT970602	hsa-miR-4429	CLIP-seq
MIRT970603	hsa-miR-4433	CLIP-seq
MIRT970394	hsa-miR-4436b-5p	CLIP-seq
MIRT970604	hsa-miR-4443	CLIP-seq
MIRT970605	hsa-miR-4446-5p	CLIP-seq
MIRT970606	hsa-miR-4450	CLIP-seq
MIRT970607	hsa-miR-4453	CLIP-seq
MIRT970608	hsa-miR-4460	CLIP-seq
MIRT970609	hsa-miR-4465	CLIP-seq
MIRT970610	hsa-miR-4473	CLIP-seq
MIRT970611	hsa-miR-4474-3p	CLIP-seq
MIRT970612	hsa-miR-4477a	CLIP-seq
MIRT970395	hsa-miR-4477b	CLIP-seq
MIRT970613	hsa-miR-4482	CLIP-seq
MIRT970614	hsa-miR-4487	CLIP-seq
MIRT970615	hsa-miR-4499	CLIP-seq
MIRT970616	hsa-miR-450b-5p	CLIP-seq
MIRT970397	hsa-miR-4514	CLIP-seq
MIRT970398	hsa-miR-4518	CLIP-seq
MIRT970399	hsa-miR-451b	CLIP-seq
MIRT970400	hsa-miR-4529-5p	CLIP-seq
MIRT970401	hsa-miR-4533	CLIP-seq
MIRT970617	hsa-miR-4538	CLIP-seq
MIRT970618	hsa-miR-454	CLIP-seq
MIRT970404	hsa-miR-4638-3p	CLIP-seq
MIRT970619	hsa-miR-4642	CLIP-seq
MIRT970620	hsa-miR-4645-5p	CLIP-seq
MIRT970405	hsa-miR-4646-3p	CLIP-seq
MIRT970621	hsa-miR-4650-5p	CLIP-seq
MIRT970622	hsa-miR-4659a-5p	CLIP-seq
MIRT970623	hsa-miR-4659b-5p	CLIP-seq
MIRT970624	hsa-miR-4660	CLIP-seq
MIRT970625	hsa-miR-4673	CLIP-seq
MIRT970406	hsa-miR-4676-5p	CLIP-seq
MIRT970626	hsa-miR-4677-3p	CLIP-seq
MIRT970627	hsa-miR-4679	CLIP-seq
MIRT970628	hsa-miR-4680-3p	CLIP-seq
MIRT970407	hsa-miR-4681	CLIP-seq
MIRT970629	hsa-miR-4682	CLIP-seq
MIRT970630	hsa-miR-4684-5p	CLIP-seq
MIRT970631	hsa-miR-4686	CLIP-seq
MIRT970632	hsa-miR-4687-5p	CLIP-seq
MIRT970633	hsa-miR-4690-3p	CLIP-seq
MIRT970409	hsa-miR-4692	CLIP-seq
MIRT970634	hsa-miR-4693-3p	CLIP-seq
MIRT970635	hsa-miR-4693-5p	CLIP-seq
MIRT970636	hsa-miR-4694-5p	CLIP-seq
MIRT970637	hsa-miR-4698	CLIP-seq
MIRT970638	hsa-miR-4708-3p	CLIP-seq
MIRT970411	hsa-miR-4711-3p	CLIP-seq
MIRT970639	hsa-miR-4713-5p	CLIP-seq
MIRT970640	hsa-miR-4714-3p	CLIP-seq
MIRT970413	hsa-miR-4716-3p	CLIP-seq
MIRT970641	hsa-miR-4720-5p	CLIP-seq
MIRT970642	hsa-miR-4722-5p	CLIP-seq
MIRT970643	hsa-miR-4723-3p	CLIP-seq
MIRT970644	hsa-miR-4725-3p	CLIP-seq
MIRT970645	hsa-miR-4727-3p	CLIP-seq
MIRT970414	hsa-miR-4733-3p	CLIP-seq
MIRT970646	hsa-miR-4735-3p	CLIP-seq
MIRT970647	hsa-miR-4736	CLIP-seq
MIRT970648	hsa-miR-4738-3p	CLIP-seq
MIRT970415	hsa-miR-4739	CLIP-seq
MIRT970416	hsa-miR-4742-5p	CLIP-seq
MIRT970649	hsa-miR-4746-5p	CLIP-seq
MIRT970417	hsa-miR-4747-5p	CLIP-seq
MIRT970650	hsa-miR-4752	CLIP-seq
MIRT970418	hsa-miR-4756-5p	CLIP-seq
MIRT970651	hsa-miR-4760-3p	CLIP-seq
MIRT970652	hsa-miR-4760-5p	CLIP-seq
MIRT970419	hsa-miR-4761-3p	CLIP-seq
MIRT970653	hsa-miR-4761-5p	CLIP-seq
MIRT970654	hsa-miR-4763-3p	CLIP-seq
MIRT970655	hsa-miR-4772-3p	CLIP-seq
MIRT970656	hsa-miR-4773	CLIP-seq
MIRT970657	hsa-miR-4774-5p	CLIP-seq
MIRT970658	hsa-miR-4775	CLIP-seq
MIRT970659	hsa-miR-4776-3p	CLIP-seq
MIRT970660	hsa-miR-4780	CLIP-seq
MIRT970421	hsa-miR-4781-3p	CLIP-seq
MIRT970661	hsa-miR-4782-3p	CLIP-seq
MIRT970662	hsa-miR-4782-5p	CLIP-seq
MIRT970663	hsa-miR-4790-3p	CLIP-seq
MIRT970422	hsa-miR-4793-3p	CLIP-seq
MIRT970664	hsa-miR-4797-5p	CLIP-seq
MIRT970665	hsa-miR-4799-3p	CLIP-seq
MIRT970423	hsa-miR-4803	CLIP-seq
MIRT970666	hsa-miR-483-3p	CLIP-seq
MIRT970667	hsa-miR-495	CLIP-seq
MIRT970668	hsa-miR-498	CLIP-seq
MIRT970669	hsa-miR-499-3p	CLIP-seq
MIRT970670	hsa-miR-499a-3p	CLIP-seq
MIRT970671	hsa-miR-502-5p	CLIP-seq
MIRT970672	hsa-miR-506	CLIP-seq
MIRT970673	hsa-miR-507	CLIP-seq
MIRT970674	hsa-miR-5095	CLIP-seq
MIRT970675	hsa-miR-512-3p	CLIP-seq
MIRT970424	hsa-miR-518a-5p	CLIP-seq
MIRT970425	hsa-miR-519a	CLIP-seq
MIRT970676	hsa-miR-519d	CLIP-seq
MIRT970426	hsa-miR-520d-5p	CLIP-seq
MIRT970677	hsa-miR-520f	CLIP-seq
MIRT970678	hsa-miR-520g	CLIP-seq
MIRT970679	hsa-miR-520h	CLIP-seq
MIRT970427	hsa-miR-524-5p	CLIP-seq
MIRT970428	hsa-miR-527	CLIP-seq
MIRT970429	hsa-miR-542-3p	CLIP-seq
MIRT970680	hsa-miR-543	CLIP-seq
MIRT970681	hsa-miR-548a-5p	CLIP-seq
MIRT970682	hsa-miR-548ab	CLIP-seq
MIRT970430	hsa-miR-548ae	CLIP-seq
MIRT970431	hsa-miR-548aj	CLIP-seq
MIRT970683	hsa-miR-548ak	CLIP-seq
MIRT970432	hsa-miR-548am	CLIP-seq
MIRT970684	hsa-miR-548an	CLIP-seq
MIRT970433	hsa-miR-548b-3p	CLIP-seq
MIRT970685	hsa-miR-548b-5p	CLIP-seq
MIRT970434	hsa-miR-548c-3p	CLIP-seq
MIRT970686	hsa-miR-548c-5p	CLIP-seq
MIRT970687	hsa-miR-548d-5p	CLIP-seq
MIRT970688	hsa-miR-548h	CLIP-seq
MIRT970689	hsa-miR-548i	CLIP-seq
MIRT970690	hsa-miR-548j	CLIP-seq
MIRT970691	hsa-miR-548n	CLIP-seq
MIRT970435	hsa-miR-548p	CLIP-seq
MIRT970692	hsa-miR-548t	CLIP-seq
MIRT970437	hsa-miR-548v	CLIP-seq
MIRT970693	hsa-miR-548w	CLIP-seq
MIRT970438	hsa-miR-548x	CLIP-seq
MIRT970694	hsa-miR-548y	CLIP-seq
MIRT970695	hsa-miR-552	CLIP-seq
MIRT970696	hsa-miR-556-5p	CLIP-seq
MIRT970697	hsa-miR-557	CLIP-seq
MIRT970698	hsa-miR-558	CLIP-seq
MIRT970699	hsa-miR-559	CLIP-seq
MIRT970700	hsa-miR-562	CLIP-seq
MIRT970439	hsa-miR-568	CLIP-seq
MIRT970440	hsa-miR-575	CLIP-seq
MIRT970701	hsa-miR-579	CLIP-seq
MIRT970442	hsa-miR-582-3p	CLIP-seq
MIRT970702	hsa-miR-583	CLIP-seq
MIRT970443	hsa-miR-586	CLIP-seq
MIRT970703	hsa-miR-589	CLIP-seq
MIRT970704	hsa-miR-590-3p	CLIP-seq
MIRT970705	hsa-miR-590-5p	CLIP-seq
MIRT970706	hsa-miR-595	CLIP-seq
MIRT970707	hsa-miR-603	CLIP-seq
MIRT970708	hsa-miR-605	CLIP-seq
MIRT970444	hsa-miR-607	CLIP-seq
MIRT970709	hsa-miR-616	CLIP-seq
MIRT970710	hsa-miR-624	CLIP-seq
MIRT970445	hsa-miR-625	CLIP-seq
MIRT970446	hsa-miR-626	CLIP-seq
MIRT970711	hsa-miR-629	CLIP-seq
MIRT970447	hsa-miR-632	CLIP-seq
MIRT970448	hsa-miR-633	CLIP-seq
MIRT970712	hsa-miR-641	CLIP-seq
MIRT970449	hsa-miR-646	CLIP-seq
MIRT970713	hsa-miR-650	CLIP-seq
MIRT970451	hsa-miR-656	CLIP-seq
MIRT970452	hsa-miR-660	CLIP-seq
MIRT970714	hsa-miR-661	CLIP-seq
MIRT970715	hsa-miR-663	CLIP-seq
MIRT970716	hsa-miR-668	CLIP-seq
MIRT970717	hsa-miR-764	CLIP-seq
MIRT970718	hsa-miR-766	CLIP-seq
MIRT970453	hsa-miR-767-3p	CLIP-seq
MIRT970454	hsa-miR-802	CLIP-seq
MIRT970455	hsa-miR-873	CLIP-seq
MIRT970456	hsa-miR-874	CLIP-seq
MIRT970719	hsa-miR-885-3p	CLIP-seq
MIRT970720	hsa-miR-885-5p	CLIP-seq
MIRT970721	hsa-miR-892a	CLIP-seq
MIRT970722	hsa-miR-921	CLIP-seq
MIRT970723	hsa-miR-93	CLIP-seq
MIRT970458	hsa-miR-934	CLIP-seq
MIRT970724	hsa-miR-943	CLIP-seq
MIRT970725	hsa-miR-96	CLIP-seq
MIRT1987567	hsa-miR-1	CLIP-seq
MIRT970464	hsa-miR-1184	CLIP-seq
MIRT970331	hsa-miR-1207-3p	CLIP-seq
MIRT970466	hsa-miR-1207-5p	CLIP-seq
MIRT970334	hsa-miR-1231	CLIP-seq
MIRT970469	hsa-miR-124	CLIP-seq
MIRT1987568	hsa-miR-1251	CLIP-seq
MIRT970472	hsa-miR-1256	CLIP-seq
MIRT970335	hsa-miR-1257	CLIP-seq
MIRT1987569	hsa-miR-125a-5p	CLIP-seq
MIRT1987570	hsa-miR-125b	CLIP-seq
MIRT970336	hsa-miR-1266	CLIP-seq
MIRT970473	hsa-miR-1271	CLIP-seq
MIRT970337	hsa-miR-1273c	CLIP-seq
MIRT1987571	hsa-miR-127-5p	CLIP-seq
MIRT970477	hsa-miR-1292	CLIP-seq
MIRT970478	hsa-miR-1297	CLIP-seq
MIRT970338	hsa-miR-1302	CLIP-seq
MIRT970480	hsa-miR-130a	CLIP-seq
MIRT970481	hsa-miR-130b	CLIP-seq
MIRT970340	hsa-miR-139-5p	CLIP-seq
MIRT970485	hsa-miR-145	CLIP-seq
MIRT1987572	hsa-miR-149	CLIP-seq
MIRT970491	hsa-miR-182	CLIP-seq
MIRT970492	hsa-miR-1827	CLIP-seq
MIRT970493	hsa-miR-18a	CLIP-seq
MIRT970494	hsa-miR-18b	CLIP-seq
MIRT970496	hsa-miR-1908	CLIP-seq
MIRT970497	hsa-miR-1909	CLIP-seq
MIRT1987573	hsa-miR-1915	CLIP-seq
MIRT970510	hsa-miR-2114	CLIP-seq
MIRT970514	hsa-miR-219-5p	CLIP-seq
MIRT970350	hsa-miR-22	CLIP-seq
MIRT970351	hsa-miR-221	CLIP-seq
MIRT970352	hsa-miR-222	CLIP-seq
MIRT970515	hsa-miR-2276	CLIP-seq
MIRT970517	hsa-miR-26a	CLIP-seq
MIRT970518	hsa-miR-26b	CLIP-seq
MIRT970521	hsa-miR-300	CLIP-seq
MIRT970522	hsa-miR-301a	CLIP-seq
MIRT970523	hsa-miR-301b	CLIP-seq
MIRT1987574	hsa-miR-3064-5p	CLIP-seq
MIRT970524	hsa-miR-3065-3p	CLIP-seq
MIRT970527	hsa-miR-3127-5p	CLIP-seq
MIRT970365	hsa-miR-3163	CLIP-seq
MIRT970536	hsa-miR-3180	CLIP-seq
MIRT970537	hsa-miR-3180-3p	CLIP-seq
MIRT970538	hsa-miR-3183	CLIP-seq
MIRT970540	hsa-miR-3196	CLIP-seq
MIRT970367	hsa-miR-338-5p	CLIP-seq
MIRT970551	hsa-miR-33a	CLIP-seq
MIRT970552	hsa-miR-33b	CLIP-seq
MIRT970368	hsa-miR-3611	CLIP-seq
MIRT970555	hsa-miR-3612	CLIP-seq
MIRT970370	hsa-miR-3614-3p	CLIP-seq
MIRT1987575	hsa-miR-3620	CLIP-seq
MIRT970558	hsa-miR-3622a-3p	CLIP-seq
MIRT970559	hsa-miR-3622b-3p	CLIP-seq
MIRT970374	hsa-miR-3664-3p	CLIP-seq
MIRT970563	hsa-miR-3671	CLIP-seq
MIRT970378	hsa-miR-3683	CLIP-seq
MIRT970565	hsa-miR-3691-3p	CLIP-seq
MIRT970567	hsa-miR-369-3p	CLIP-seq
MIRT970568	hsa-miR-3714	CLIP-seq
MIRT1987576	hsa-miR-371b-3p	CLIP-seq
MIRT970570	hsa-miR-374a	CLIP-seq
MIRT970571	hsa-miR-374b	CLIP-seq
MIRT970573	hsa-miR-381	CLIP-seq
MIRT970575	hsa-miR-3910	CLIP-seq
MIRT1987577	hsa-miR-3918	CLIP-seq
MIRT970578	hsa-miR-3925-3p	CLIP-seq
MIRT970384	hsa-miR-3936	CLIP-seq
MIRT970388	hsa-miR-4269	CLIP-seq
MIRT970584	hsa-miR-4271	CLIP-seq
MIRT970588	hsa-miR-4278	CLIP-seq
MIRT970389	hsa-miR-4288	CLIP-seq
MIRT970591	hsa-miR-4291	CLIP-seq
MIRT970391	hsa-miR-4298	CLIP-seq
MIRT970595	hsa-miR-4317	CLIP-seq
MIRT1987578	hsa-miR-4319	CLIP-seq
MIRT970393	hsa-miR-4325	CLIP-seq
MIRT970599	hsa-miR-4326	CLIP-seq
MIRT970601	hsa-miR-4427	CLIP-seq
MIRT970603	hsa-miR-4433	CLIP-seq
MIRT970604	hsa-miR-4443	CLIP-seq
MIRT970605	hsa-miR-4446-5p	CLIP-seq
MIRT970606	hsa-miR-4450	CLIP-seq
MIRT970609	hsa-miR-4465	CLIP-seq
MIRT970395	hsa-miR-4477b	CLIP-seq
MIRT970616	hsa-miR-450b-5p	CLIP-seq
MIRT970397	hsa-miR-4514	CLIP-seq
MIRT970398	hsa-miR-4518	CLIP-seq
MIRT1987579	hsa-miR-4527	CLIP-seq
MIRT970401	hsa-miR-4533	CLIP-seq
MIRT970618	hsa-miR-454	CLIP-seq
MIRT970619	hsa-miR-4642	CLIP-seq
MIRT1987580	hsa-miR-4659a-3p	CLIP-seq
MIRT970622	hsa-miR-4659a-5p	CLIP-seq
MIRT1987581	hsa-miR-4659b-3p	CLIP-seq
MIRT970623	hsa-miR-4659b-5p	CLIP-seq
MIRT1987582	hsa-miR-4661-5p	CLIP-seq
MIRT970626	hsa-miR-4677-3p	CLIP-seq
MIRT970627	hsa-miR-4679	CLIP-seq
MIRT970628	hsa-miR-4680-3p	CLIP-seq
MIRT970407	hsa-miR-4681	CLIP-seq
MIRT970630	hsa-miR-4684-5p	CLIP-seq
MIRT1987583	hsa-miR-4685-5p	CLIP-seq
MIRT970408	hsa-miR-4687-3p	CLIP-seq
MIRT970409	hsa-miR-4692	CLIP-seq
MIRT970634	hsa-miR-4693-3p	CLIP-seq
MIRT1987584	hsa-miR-4706	CLIP-seq
MIRT970638	hsa-miR-4708-3p	CLIP-seq
MIRT970411	hsa-miR-4711-3p	CLIP-seq
MIRT1987585	hsa-miR-4713-3p	CLIP-seq
MIRT970413	hsa-miR-4716-3p	CLIP-seq
MIRT970642	hsa-miR-4722-5p	CLIP-seq
MIRT970643	hsa-miR-4723-3p	CLIP-seq
MIRT970644	hsa-miR-4725-3p	CLIP-seq
MIRT1987586	hsa-miR-4726-3p	CLIP-seq
MIRT970646	hsa-miR-4735-3p	CLIP-seq
MIRT970647	hsa-miR-4736	CLIP-seq
MIRT970416	hsa-miR-4742-5p	CLIP-seq
MIRT970417	hsa-miR-4747-5p	CLIP-seq
MIRT1987587	hsa-miR-4749-5p	CLIP-seq
MIRT970652	hsa-miR-4760-5p	CLIP-seq
MIRT970654	hsa-miR-4763-3p	CLIP-seq
MIRT970655	hsa-miR-4772-3p	CLIP-seq
MIRT970658	hsa-miR-4775	CLIP-seq
MIRT970659	hsa-miR-4776-3p	CLIP-seq
MIRT970421	hsa-miR-4781-3p	CLIP-seq
MIRT970661	hsa-miR-4782-3p	CLIP-seq
MIRT970422	hsa-miR-4793-3p	CLIP-seq
MIRT1987588	hsa-miR-4794	CLIP-seq
MIRT970672	hsa-miR-506	CLIP-seq
MIRT970673	hsa-miR-507	CLIP-seq
MIRT970424	hsa-miR-518a-5p	CLIP-seq
MIRT970428	hsa-miR-527	CLIP-seq
MIRT970437	hsa-miR-548v	CLIP-seq
MIRT970697	hsa-miR-557	CLIP-seq
MIRT970443	hsa-miR-586	CLIP-seq
MIRT970704	hsa-miR-590-3p	CLIP-seq
MIRT1987589	hsa-miR-613	CLIP-seq
MIRT970709	hsa-miR-616	CLIP-seq
MIRT970447	hsa-miR-632	CLIP-seq
MIRT970713	hsa-miR-650	CLIP-seq
MIRT970715	hsa-miR-663	CLIP-seq
MIRT1987590	hsa-miR-744	CLIP-seq
MIRT970453	hsa-miR-767-3p	CLIP-seq
MIRT1987591	hsa-miR-942	CLIP-seq
MIRT970725	hsa-miR-96	CLIP-seq
MIRT970459	hsa-miR-103a	CLIP-seq
MIRT970463	hsa-miR-107	CLIP-seq
MIRT1987592	hsa-miR-1278	CLIP-seq
MIRT970478	hsa-miR-1297	CLIP-seq
MIRT970480	hsa-miR-130a	CLIP-seq
MIRT970481	hsa-miR-130b	CLIP-seq
MIRT970345	hsa-miR-188-5p	CLIP-seq
MIRT970493	hsa-miR-18a	CLIP-seq
MIRT970494	hsa-miR-18b	CLIP-seq
MIRT970351	hsa-miR-221	CLIP-seq
MIRT970352	hsa-miR-222	CLIP-seq
MIRT970517	hsa-miR-26a	CLIP-seq
MIRT970518	hsa-miR-26b	CLIP-seq
MIRT970522	hsa-miR-301a	CLIP-seq
MIRT970523	hsa-miR-301b	CLIP-seq
MIRT970354	hsa-miR-302a	CLIP-seq
MIRT970355	hsa-miR-302b	CLIP-seq
MIRT970356	hsa-miR-302c	CLIP-seq
MIRT970357	hsa-miR-302d	CLIP-seq
MIRT970365	hsa-miR-3163	CLIP-seq
MIRT970547	hsa-miR-323b-3p	CLIP-seq
MIRT970371	hsa-miR-3618	CLIP-seq
MIRT970372	hsa-miR-3646	CLIP-seq
MIRT970563	hsa-miR-3671	CLIP-seq
MIRT970565	hsa-miR-3691-3p	CLIP-seq
MIRT970379	hsa-miR-372	CLIP-seq
MIRT970380	hsa-miR-373	CLIP-seq
MIRT970609	hsa-miR-4465	CLIP-seq
MIRT970397	hsa-miR-4514	CLIP-seq
MIRT1987593	hsa-miR-452	CLIP-seq
MIRT970618	hsa-miR-454	CLIP-seq
MIRT970403	hsa-miR-455-5p	CLIP-seq
MIRT1987594	hsa-miR-4676-3p	CLIP-seq
MIRT970408	hsa-miR-4687-3p	CLIP-seq
MIRT970409	hsa-miR-4692	CLIP-seq
MIRT970414	hsa-miR-4733-3p	CLIP-seq
MIRT970646	hsa-miR-4735-3p	CLIP-seq
MIRT970416	hsa-miR-4742-5p	CLIP-seq
MIRT970656	hsa-miR-4773	CLIP-seq
MIRT970437	hsa-miR-548v	CLIP-seq
MIRT970441	hsa-miR-576-3p	CLIP-seq
MIRT970458	hsa-miR-934	CLIP-seq
MIRT970459	hsa-miR-103a	CLIP-seq
MIRT970463	hsa-miR-107	CLIP-seq
MIRT970332	hsa-miR-1226	CLIP-seq
MIRT970333	hsa-miR-1227	CLIP-seq
MIRT970334	hsa-miR-1231	CLIP-seq
MIRT970480	hsa-miR-130a	CLIP-seq
MIRT970481	hsa-miR-130b	CLIP-seq
MIRT970340	hsa-miR-139-5p	CLIP-seq
MIRT970487	hsa-miR-146b-3p	CLIP-seq
MIRT970345	hsa-miR-188-5p	CLIP-seq
MIRT970497	hsa-miR-1909	CLIP-seq
MIRT1987573	hsa-miR-1915	CLIP-seq
MIRT970348	hsa-miR-204	CLIP-seq
MIRT970349	hsa-miR-211	CLIP-seq
MIRT970351	hsa-miR-221	CLIP-seq
MIRT970352	hsa-miR-222	CLIP-seq
MIRT970522	hsa-miR-301a	CLIP-seq
MIRT970523	hsa-miR-301b	CLIP-seq
MIRT970535	hsa-miR-3173-5p	CLIP-seq
MIRT970366	hsa-miR-3187-3p	CLIP-seq
MIRT2222000	hsa-miR-3189-5p	CLIP-seq
MIRT970371	hsa-miR-3618	CLIP-seq
MIRT970558	hsa-miR-3622a-3p	CLIP-seq
MIRT970559	hsa-miR-3622b-3p	CLIP-seq
MIRT970372	hsa-miR-3646	CLIP-seq
MIRT2222001	hsa-miR-3652	CLIP-seq
MIRT2222002	hsa-miR-3662	CLIP-seq
MIRT970376	hsa-miR-3673	CLIP-seq
MIRT970377	hsa-miR-3677-5p	CLIP-seq
MIRT970575	hsa-miR-3910	CLIP-seq
MIRT970385	hsa-miR-3945	CLIP-seq
MIRT970388	hsa-miR-4269	CLIP-seq
MIRT970584	hsa-miR-4271	CLIP-seq
MIRT970587	hsa-miR-4276	CLIP-seq
MIRT970389	hsa-miR-4288	CLIP-seq
MIRT970592	hsa-miR-4302	CLIP-seq
MIRT2222003	hsa-miR-4430	CLIP-seq
MIRT970611	hsa-miR-4474-3p	CLIP-seq
MIRT2222004	hsa-miR-4505	CLIP-seq
MIRT970400	hsa-miR-4529-5p	CLIP-seq
MIRT970401	hsa-miR-4533	CLIP-seq
MIRT970618	hsa-miR-454	CLIP-seq
MIRT970403	hsa-miR-455-5p	CLIP-seq
MIRT2222005	hsa-miR-4640-5p	CLIP-seq
MIRT970406	hsa-miR-4676-5p	CLIP-seq
MIRT970408	hsa-miR-4687-3p	CLIP-seq
MIRT970644	hsa-miR-4725-3p	CLIP-seq
MIRT2222006	hsa-miR-4726-5p	CLIP-seq
MIRT2222007	hsa-miR-4731-5p	CLIP-seq
MIRT970414	hsa-miR-4733-3p	CLIP-seq
MIRT970417	hsa-miR-4747-5p	CLIP-seq
MIRT2222008	hsa-miR-4758-3p	CLIP-seq
MIRT970419	hsa-miR-4761-3p	CLIP-seq
MIRT970656	hsa-miR-4773	CLIP-seq
MIRT970437	hsa-miR-548v	CLIP-seq
MIRT970440	hsa-miR-575	CLIP-seq
MIRT970441	hsa-miR-576-3p	CLIP-seq
MIRT970443	hsa-miR-586	CLIP-seq
MIRT970704	hsa-miR-590-3p	CLIP-seq
MIRT970447	hsa-miR-632	CLIP-seq
MIRT970448	hsa-miR-633	CLIP-seq
MIRT970450	hsa-miR-647	CLIP-seq
MIRT970456	hsa-miR-874	CLIP-seq
MIRT970458	hsa-miR-934	CLIP-seq
MIRT970334	hsa-miR-1231	CLIP-seq
MIRT970478	hsa-miR-1297	CLIP-seq
MIRT2222009	hsa-miR-219-2-3p	CLIP-seq
MIRT970517	hsa-miR-26a	CLIP-seq
MIRT970518	hsa-miR-26b	CLIP-seq
MIRT2222010	hsa-miR-2964a-3p	CLIP-seq
MIRT970372	hsa-miR-3646	CLIP-seq
MIRT970377	hsa-miR-3677-5p	CLIP-seq
MIRT970388	hsa-miR-4269	CLIP-seq
MIRT970389	hsa-miR-4288	CLIP-seq
MIRT970601	hsa-miR-4427	CLIP-seq
MIRT970608	hsa-miR-4460	CLIP-seq
MIRT970609	hsa-miR-4465	CLIP-seq
MIRT970645	hsa-miR-4727-3p	CLIP-seq
MIRT970414	hsa-miR-4733-3p	CLIP-seq
MIRT970656	hsa-miR-4773	CLIP-seq
MIRT970421	hsa-miR-4781-3p	CLIP-seq
MIRT970447	hsa-miR-632	CLIP-seq
MIRT970466	hsa-miR-1207-5p	CLIP-seq
MIRT1987577	hsa-miR-3918	CLIP-seq
MIRT970647	hsa-miR-4736	CLIP-seq
MIRT970654	hsa-miR-4763-3p	CLIP-seq
MIRT970557	hsa-miR-3617	CLIP-seq
MIRT970394	hsa-miR-4436b-5p	CLIP-seq
MIRT970712	hsa-miR-641	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARNT	Unknown	17991765
BARD1	Activation	20060929
BARX2	Unknown	16636675
BRCA1	Activation	20060929
DNMT1	Unknown	21655924;23242655
ESR1	Unknown	16636675
FOXA1	Unknown	20501593;24290378
GATA3	Unknown	17616709
HDAC1	Repression	18316616;20101232;23242655
HDAC1	Unknown	21655924
HDAC7	Repression	21078666
HDAC9	Repression	19185986
KDM4B	Unknown	23723241
LEF1	Unknown	18794125
LMO4	Unknown	16288053
MECP2	Repression	15870696
MECP2	Unknown	21655924;23242655
MTA1	Repression	24413532
MTA1	Unknown	11146623
NCOR1	Repression	20101232
NKX3-1	Unknown	18794125
NR2E3	Unknown	22174013
PGR	Activation	16982776
PIAS3	Unknown	22174013
RUNX2	Unknown	17350616
SP1	Unknown	12237165;21235772
STAT5A	Unknown	11731618
STAT5B	Unknown	11731618
TFAP2C	Activation	11278455;19458056
TP53	Unknown	21655924
TWIST1	Repression	22056872
XBP1	Activation	15882996

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	20388878
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	15831516, 20388878, 21131358
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IDA	17505058
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12047722, 15345745
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001093	Function	TFIIB-class transcription factor binding	IPI	9841876
GO:0001221	Function	Transcription coregulator binding	IPI	14701856
GO:0001222	Function	Transcription corepressor binding	IPI	12535528
GO:0001223	Function	Transcription coactivator binding	IPI	21642474
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12047722
GO:0001547	Process	Antral ovarian follicle growth	IEA
GO:0002064	Process	Epithelial cell development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	17505058, 20080953
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	12552091
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	15831516
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IGI	18722177
GO:0005496	Function	Steroid binding	IEA
GO:0005496	Function	Steroid binding	ISS
GO:0005515	Function	Protein binding	IPI	1517211, 7641693, 7651415, 9328340, 9627117, 9628876, 9653119, 10359819, 10816575, 10866662, 11032808, 11178989, 11265755, 11279242, 11353774, 11477071, 11581164, 11682626, 11875103, 12039952, 12093804, 12612073, 12660241, 12904255, 12917342, 14764652, 14963108, 15199063, 15569929, 1
GO:0005516	Function	Calmodulin binding	EXP	22275375
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20074560
GO:0005634	Component	Nucleus	IDA	9841876, 15569929, 17505058, 20074560, 20080953, 22693546
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	26733313
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IPI	11265755
GO:0005737	Component	Cytoplasm	IDA	17505058, 22693546
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	15569929
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006338	Process	Chromatin remodeling	NAS	12351687
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	3753802
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007165	Process	Signal transduction	TAS	10749889, 10970861
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0008013	Function	Beta-catenin binding	IPI	15304487
GO:0008209	Process	Androgen metabolic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	21695196
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11960618
GO:0017025	Function	TBP-class protein binding	IPI	11595744
GO:0019899	Function	Enzyme binding	IPI	12039952, 22853951
GO:0019901	Function	Protein kinase binding	IPI	28068668
GO:0030235	Function	Nitric-oxide synthase regulator activity	NAS	12389206
GO:0030284	Function	Nuclear estrogen receptor activity	IC	22031296
GO:0030284	Function	Nuclear estrogen receptor activity	IDA	9338790, 9841876, 15831516
GO:0030284	Function	Nuclear estrogen receptor activity	IEA
GO:0030284	Function	Nuclear estrogen receptor activity	IMP	16645038
GO:0030284	Function	Nuclear estrogen receptor activity	NAS	3753802
GO:0030284	Function	Nuclear estrogen receptor activity	TAS	11004670
GO:0030331	Function	Nuclear estrogen receptor binding	IPI	9841876
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	ISS
GO:0030520	Process	Estrogen receptor signaling pathway	IBA
GO:0030520	Process	Estrogen receptor signaling pathway	IDA	7481822
GO:0030520	Process	Estrogen receptor signaling pathway	IDA	9338790, 9841876, 15831516
GO:0030520	Process	Estrogen receptor signaling pathway	IEA
GO:0030520	Process	Estrogen receptor signaling pathway	NAS	3753802
GO:0032355	Process	Response to estradiol	IDA	15304487
GO:0032991	Component	Protein-containing complex	IDA	20080953
GO:0032991	Component	Protein-containing complex	IMP	11595744
GO:0034056	Function	Estrogen response element binding	IBA
GO:0034056	Function	Estrogen response element binding	IDA	9841876, 15345745, 15831516, 17975005
GO:0034056	Function	Estrogen response element binding	IEA
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	IEA
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	ISS
GO:0042802	Function	Identical protein binding	IPI	11265755, 11682626, 18474858, 19022902, 21182205, 23065768, 31527615
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	7651415, 16043358
GO:0043401	Process	Steroid hormone receptor signaling pathway	IC	22031296
GO:0043401	Process	Steroid hormone receptor signaling pathway	IEA
GO:0043401	Process	Steroid hormone receptor signaling pathway	IMP	16645038
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	10816575
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043627	Process	Response to estrogen	IDA	11581164
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IDA	21937726
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	20074560
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11544182
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9841876, 11265755, 12047722, 15345745, 15831516, 18563714
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0051000	Process	Positive regulation of nitric-oxide synthase activity	IDA	21937726
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	9328340, 10681512
GO:0051117	Function	ATPase binding	IDA	12058073
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IDA	9841876
GO:0060065	Process	Uterus development	IEA
GO:0060068	Process	Vagina development	IEA
GO:0060523	Process	Prostate epithelial cord elongation	IEA
GO:0060527	Process	Prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	IEA
GO:0060687	Process	Regulation of branching involved in prostate gland morphogenesis	IEA
GO:0060745	Process	Mammary gland branching involved in pregnancy	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0060750	Process	Epithelial cell proliferation involved in mammary gland duct elongation	IEA
GO:0071168	Process	Protein localization to chromatin	IMP	20388878
GO:0071391	Process	Cellular response to estrogen stimulus	IBA
GO:0071391	Process	Cellular response to estrogen stimulus	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IDA	12535528, 15831516
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	ISS
GO:0071889	Function	14-3-3 protein binding	IPI	21946067
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	IMP	20388878
GO:1904035	Process	Regulation of epithelial cell apoptotic process	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 133430
• HGNC: 3467
• e!Ensembl: ENSG00000091831

Protein

• UniProt ID: P03372
• Protein name: Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
• Protein function: Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation inv
• PDB: 1A52, 1ERE, 1ERR, 1G50, 1GWQ, 1GWR, 1HCP, 1HCQ, 1L2I, 1PCG, 1QKT, 1QKU, 1R5K, 1SJ0, 1UOM, 1X7E, 1X7R, 1XP1, 1XP6, 1XP9, 1XPC, 1XQC, 1YIM, 1YIN, 1ZKY, 2AYR, 2B1V, 2B1Z, 2B23, 2BJ4, 2FAI, 2G44, 2G5O, 2I0J, 2IOG, 2IOK, 2JF9, 2JFA, 2LLO, 2LLQ, 2OCF, 2OUZ, 2P15, 2POG, 2Q6J, 2Q70, 2QA6, 2QA8, 2QAB, 2QE4, 2QGT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02159	Oest_recep	42 → 181	Oestrogen receptor	Family
  PF00105	zf-C4	183 → 252	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	332 → 531	Ligand-binding domain of nuclear hormone receptor	Domain
  PF12743	ESR1_C	552 → 595	Oestrogen-type nuclear receptor final C-terminal	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed (PubMed:10970861). Not expressed in the pituitary gland (PubMed:10970861). {ECO:0000269|PubMed:10970861}.; TISSUE SPECIFICITY: [Isoform 3]: Widely expressed, however not expressed in the pituitary gland. {ECO:0000269|P
• Sequence:

  MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
  EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
  LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
  ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
  RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
  SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
  AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
  MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
  KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
  LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV

• Sequence length: 595

Pathways

KEGG:

Endocrine resistance
Hormone signaling
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Pathways in cancer
Proteoglycans in cancer
Chemical carcinogenesis - receptor activation
Breast cancer

Reactome:

Nuclear signaling by ERBB4
PIP3 activates AKT signaling
Constitutive Signaling by Aberrant PI3K in Cancer
Nuclear Receptor transcription pathway
SUMOylation of intracellular receptors
Ovarian tumor domain proteases
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
TFAP2 (AP-2) family regulates transcription of growth factors and their receptors
RUNX1 regulates estrogen receptor mediated transcription
ESR-mediated signaling
RUNX1 regulates transcription of genes involved in WNT signaling
Regulation of RUNX2 expression and activity
Extra-nuclear estrogen signaling
Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Estrogen receptor mutant, temperature-sensitive	Pathogenic	rs121913043	RCV000018058	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Estrogen resistance syndrome	Pathogenic; Likely pathogenic	rs104893956, rs1131692059, rs397509428	RCV000018060 RCV000495838 RCV000054445	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHROGRYPOSIS MULTIPLEX CONGENITA 3, MYOGENIC TYPE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASES, METABOLIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRCAX BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog, HPO GWAS catalog, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL PRECOCIOUS PUBERTY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBELLAR ATAXIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMERY-DREIFUSS MUSCULAR DYSTROPHY 4	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESR1-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN RESISTANCE	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE INFERTILITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE UROGENITAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, MALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIOMYOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC BONE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with or without aura, susceptibility to	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with or without aura, susceptibility to, 1	Benign; Likely benign	ClinVar CTD, ClinVar CTD, ClinVar	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MITOCHONDRIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial infarction, susceptibility to	Benign; Likely benign; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC INTRAEPITHELIAL NEOPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPECIFIC LANGUAGE IMPAIRMENT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA, AUTOSOMAL RECESSIVE 8	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abdominal Migraine	Abdominal Migraine	CTD_human_DG	15133719		★☆☆☆☆ Found in Text Mining only
Acanthosis Nigricans	Acanthosis Nigricans	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acne	Acne	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	9143583		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	23763623		★☆☆☆☆ Found in Text Mining only
Acute Confusional Migraine	Confusional Migraine	CTD_human_DG	15133719		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	22168360		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	7522544		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10353741		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29550797		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11489814, 11687977, 12679906, 15639718, 15900599, 16565509, 16736496, 1682189, 17108100, 17561234, 19706809, 19875957, 20458558, 20482834, 20534993, 20615575, 20655063, 22170435, 23318908, 23362007, 25692143, 28745321, 28862203, 28937296, 29465823, 29935374, 30087072, 30227306, 31483053, 31778358, 8729985, 9848511		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	14674143, 16271083, 17046193		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	15639718, 20458558		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	26406593		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16601283, 19064969, 19556604, 19706809, 19875957, 20615575, 21862684, 21920623, 22784503, 23855798, 26301798, 26468985, 28522562, 28574279, 28693248, 29465823, 31289556, 31611968		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	31568691		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	11536308, 21139866, 9266239		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	15639718, 20458558		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	27167671, 28984301		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	11342781, 17561234, 20596625, 22720981, 24335662, 26871282, 28937296, 30022838		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	15639718, 20458558		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	15639718, 20458558		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	BEFREE	25357113		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	15103224		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15894675, 19302287, 19733896, 20797424, 21270509, 23328702, 8288720, 8530610, 8733768		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	19302287, 23328702		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	17873900, 18498351, 19367284, 20446826, 20572039, 20696638, 28681123		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	LHGDN	18498351		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	28681123		★☆☆☆☆ Found in Text Mining only
Adolescent Gynecomastia	Pubertal gynecomastia	BEFREE	21597315		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	LHGDN	18508999		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	16216906, 23074235, 26131713, 26312764, 29112114		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	LHGDN	18157729		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	19198016, 33981288	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	10353741		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27357538		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19008315, 22439007, 22454254, 25885794, 28877739		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	18359774		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	23074235, 23374397, 26131713, 29112114		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12852830, 18288931, 18408366, 19586561, 20221449, 23491264, 24732579, 26837465, 30222591, 31175839, 36326669, 36697247	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	20674091, 26553058		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22119000		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29807145		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	14555521, 19416752, 24752964, 26372732, 7995615		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	11604247		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	15637090, 17173897		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	23841731, 27754803, 36401248	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	16648749, 17023856, 21520258, 21691901, 22002330, 22009847, 31483053		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30655091		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	35732909	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	3582068	Inhibit	★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	29388081		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	25005770, 26261626, 26812031, 28362980, 28971528, 29530480, 30900036, 31033231		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30373552		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	29097993		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	11803451, 20375995, 24106242, 24282178, 31714887		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	20375995	Associate	★☆☆☆☆ Found in Text Mining only
Anovulation	Anovulation	Pubtator	36063826	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	10483055, 11857578, 20616674, 21570196, 22901010, 28061972, 28845177, 31009113, 31331849, 31342369, 31823143		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	21570196, 31906708	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	10483055, 11857578, 20616674, 21570196, 22901010, 28061972, 28845177, 31009113, 31331849, 31342369, 31823143		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	21570196, 31906708, 33849116	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	23993200		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	15698546, 23993200		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	19638585, 22745190, 25625755, 27029552, 27801670, 28283903, 28916342, 29092024, 29131020, 30223929, 31434793		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	15533858		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	23074235, 23374397, 26131713, 29112114		★☆☆☆☆ Found in Text Mining only
Aromatase deficiency	Aromatase Deficiency	BEFREE	12466340		★☆☆☆☆ Found in Text Mining only
AROMATASE EXCESS SYNDROME	Aromatase Excess Syndrome	BEFREE	28112739		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11894143, 12568733, 17513703, 17558892, 17971628, 19958400, 23519120, 25532911, 25836047, 27171902, 29331506, 29975924, 30010822, 31381601, 31449974		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	37864259	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20131258, 21506092, 27028940, 30762291, 31055232		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	31616008	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	36262248	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24089231, 33977746, 36262248	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31033231, 31327053, 31435754		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	30053825		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16522460, 27277384, 27808402, 30958966, 31617730, 31638834		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21940647, 27808402	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31617730	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11604247, 19822186, 20963570, 22142990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	22142990, 24843314, 30569990	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	11894143, 12568733, 17513703, 17558892, 17971628, 19958400, 23519120, 25532911, 25836047, 27171902, 29331506, 29975924, 30010822, 31381601, 31449974		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	11894143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	11894143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	17213955, 17903303, 19958400, 25836047, 28698603, 35197230, 36142876	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	24577825	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	28617822	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	11267940, 24596378		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	29686828, 36401485	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28734238, 29526366, 29686828		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10779406, 14662901, 22466402, 24861435, 29144542, 29666308, 30988419, 31345653, 31703914		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	18835831, 23913373, 34398012	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	21430602		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21975296, 25124606, 25179840, 29394243, 29932870, 31078693		★☆☆☆☆ Found in Text Mining only
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	BEFREE	30061207		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	11016622, 26406593		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	26406593	Associate	★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	28617822		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	30101545		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	30194396		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10676656, 11096250, 17640960, 21181231, 21620560, 24752964, 27880726, 28353585, 28412354, 28850686, 28941035, 30708032		★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	33250473	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	16273733	Associate	★☆☆☆☆ Found in Text Mining only
bilateral breast cancer	Breast Cancer	BEFREE	15941968, 30618092		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	20172949		★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	20172949, 31867004	Associate	★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	20172949	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	15645536		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	20172949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	20172949	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11121195, 15576061, 22389694		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11121195, 11807414, 12627470, 15576061, 22389694		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	15576061		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	22389694, 28617822, 31906708	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder neck obstruction	Bladder neck obstruction	BEFREE	21356374		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	16712894		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24148819, 25277204, 27092883, 28362839, 29567231, 30511377, 30573691, 30737158, 31455760		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	31291549		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	10703934, 11092403, 15237001, 22151997, 22174377, 26590813, 29029636, 33307492, 8090165	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases	Bone Disease	BEFREE	16988190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases	Bone Disease	CTD_human_DG	28505433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases Metabolic	Bone disease	Pubtator	11092403, 17324916, 18505767, 24841655, 26536870, 36151243, 9556070	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	14528100, 27776343, 29133279		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	22898337, 33355355	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	35568086	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	16675566, 21914172, 24968695, 26500237, 27764697, 27926948, 28467804, 32326116, 34499316	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25802405, 2703268		★☆☆☆☆ Found in Text Mining only
Branchioma	Branchioma	BEFREE	29410959		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	12377985, 16080910, 19021152, 20458558, 23465317, 23913582, 24390234, 26178079		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	16704985, 18405391, 19298662, 21922275, 23354978, 7861463, 9241077		★☆☆☆☆ Found in Text Mining only
Breast cancer, lobular	Breast Cancer	BEFREE	19812674, 24815444		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10022453, 10022773, 10030690, 10066069, 10096242, 10101196, 10330684, 10338072, 10355743, 10357772, 10359819, 10375022, 10379895, 10385549, 10389938, 10419456, 10424404, 10440698, 10446899, 10459848, 10471050, 10477167, 10517346, 10519397, 10521493, 10542244, 10554009, 10554010, 10601561, 10612431, 10619354, 10630402, 10634517, 10639512, 10676630, 10680597, 10690532, 10717624, 10754501, 10763153, 10766163, 10766344, 10782886, 10800077, 10810301, 10815765, 10819506, 10819507, 10822014, 10825128, 10831156, 10845812, 10850416, 10861509, 10866661, 10868478, 10874041, 10890895, 10894150, 10914724, 10940647, 10953303, 10955825, 10967555, 10969774, 10970861, 10999774, 11004670, 11004691, 11012095, 11014213, 11042568, 11050174, 11059753, 11072241, 11072781, 11084868, 11103799, 11110848, 11133808, 11134191, 11136970, 11156322, 11159857, 11165756, 11169738, 11186170, 11216911, 11226828, 11237771, 11241756, 11244506, 11245479, 11289701, 11311599, 11320145, 11376135, 11384768, 11400122, 11410514, 11429696, 11459795, 11494058, 11496303, 11502892, 11507038, 11519865, 11555606, 11562176, 11676860, 11693462, 11705859, 11711119, 11731427, 11738552, 11738556, 11742495, 11768608, 11779841, 11781824, 11782356, 11782368, 11782371, 11821247, 11830647, 11859876, 11866593, 11867202, 11867264, 11879565, 11888893, 11897503, 11911440, 11911945, 11931841, 11952337, 11968011, 11981002, 12004807, 12014631, 12037682, 12088871, 12100115, 12112006, 12114443, 12125913, 12140767, 12154049, 12160997, 12174911, 12183401, 12196923, 12208729, 12208749, 12208864, 12385002, 12408373, 12429812, 12432273, 12438565, 12441364, 12451035, 12459712, 12462383, 12527894, 12527905, 12529347, 12554767, 12560434, 12569569, 12589938, 12615709, 12616383, 12631589, 12644823, 12654308, 12657462, 12705869, 12710998, 12726856, 12727813, 12730327, 12736560, 12736563, 12738788, 12746304, 12789259, 12790782, 12790785, 12790787, 12810680, 12817998, 12839940, 12874002, 12879463, 12889606, 12902984, 12908818, 12929585, 12943695, 12943740, 1295449, 12970748, 1345763, 1362141, 1381277, 1421423, 1423300, 14504194, 14507640, 14522892, 14559831, 14572667, 14576841, 14580261, 14614325, 14637391, 14638681, 14645421, 14661035, 14676837, 14680484, 14682440, 14702633, 14708971, 14713265, 14715875, 14718389, 14729654, 1495491, 14973112, 14981916, 1498488, 14985456, 15001399, 15008248, 15012604, 15012607, 15016320, 15026085, 15026626, 15041722, 15044858, 15059906, 15060629, 15073102, 15084237, 15084241, 15084249, 15087408, 15111762, 15126109, 15135471, 15149721, 15149724, 15171723, 15171727, 1517234, 15175332, 15182430, 15183535, 15212714, 15217512, 15254667, 15254972, 15283693, 15311216, 15328174, 15372466, 15374949, 1537883, 15383631, 15449313, 15459489, 15481440, 15528301, 15544494, 15548683, 15581976, 15585645, 15591335, 15604249, 15604281, 15623657, 15637147, 15662126, 15681518, 15692750, 15695404, 15701881, 15703542, 15709176, 15723605, 15735025, 15746191, 15762987, 15772083, 15796211, 15816560, 15821115, 15821116, 15824731, 15824740, 15831516, 15856463, 15862952, 15867365, 15867376, 1587835, 15886208, 15923424, 15930460, 15945099, 15947004, 15986123, 15989967, 15999154, 15999367, 16012712, 1603086, 16033833, 16054421, 16084894, 16091743, 16093440, 16099479, 16103452, 16119004, 16140974, 16150902, 16152589, 16166291, 16168103, 16168121, 16168139, 16172792, 16215870, 16222150, 16243802, 16245302, 16267616, 16280033, 16284392, 16288120, 16297086, 16314399, 16319983, 16328721, 16331276, 16391838, 16401708, 16417653, 16424042, 16446345, 16455026, 16475675, 16475975, 16489054, 16491124, 16492926, 16502042, 16505416, 16514628, 16541309, 16551498, 16551856, 16551874, 16569260, 16585197, 16585219, 16601291, 16609009, 16609042, 16615154, 16617102, 16635015, 16636675, 1664044, 16679312, 16707596, 16723304, 16723714, 16728566, 16737553, 16740736, 16740749, 16754886, 16760653, 16788379, 16791593, 16808847, 16809439, 16809442, 16826462, 16827106, 16849553, 16849564, 16849584, 16867866, 16885352, 16886637, 16893382, 16893667, 16919882, 16941532, 16945990, 16951146, 16954440, 16969100, 16980581, 16998594, 17010071, 17010072, 1701124, 17013392, 17014703, 17016654, 17018635, 17068199, 17076897, 17078870, 17083744, 17089000, 17092701, 17095596, 17108141, 17127330, 17140257, 17145895, 17158757, 17158758, 17158759, 17170218, 17186358, 17187234, 17187513, 17187826, 17206280, 17215075, 1722871, 17268813, 17275315, 17280502, 1728420, 17297453, 17312270, 17329190, 17360330, 17395975, 17401012, 17417639, 17428314, 17434921, 17447208, 17453340, 17456797, 17475478, 17477366, 17510434, 17545528, 17545614, 17553133, 17562079, 1756266, 1756270, 17574840, 17578664, 17587186, 17591841, 17594514, 17596930, 17598908, 17599055, 17617929, 17634531, 1763658, 17646931, 1764697, 17660348, 17662154, 17663798, 17671699, 17683518, 17685448, 17687644, 17690249, 17699777, 17700572, 17710163, 17761946, 17785450, 1779964, 1779972, 17850661, 17880733, 17889406, 17894856, 17899364, 17904846, 17908967, 17909269, 17911387, 17914099, 17926035, 17932744, 17957784, 17973251, 17992394, 17993718, 18000217, 18000219, 18006786, 18006915, 18020983, 18022314, 18030330, 18037997, 18048329, 18056179, 18056180, 18059161, 18076012, 18078353, 18086271, 18091988, 18172323, 18183590, 18211679, 18223215, 18224398, 18226260, 18231641, 18240019, 18243688, 18254957, 18256928, 18268121, 18271972, 18281517, 18288417, 18288420, 18301357, 18307012, 18310279, 18316615, 1832273, 18337089, 18342836, 18365014, 18377699, 18386815, 18398030, 18409071, 18417735, 18420392, 18424034, 18425577, 18431487, 18438407, 18439640, 18446835, 18451179, 18457947, 18473934, 18483177, 18485221, 18497058, 18497066, 18498876, 18499701, 18501937, 18508997, 18518979, 18521745, 18550772, 18563553, 18565642, 18574464, 18592372, 18593897, 18593943, 18628976, 18629629, 18631401, 18637494, 18644889, 18645020, 18657139, 18668363, 18678474, 18705646, 18710328, 18712725, 18714337, 18714348, 18720455, 18752184, 18755890, 18768663, 18784357, 18787018, 18790736, 18828900, 1883387, 18837889, 18838536, 18843012, 18845558, 18945339, 18958632, 18979234, 18981002, 18984771, 18991569, 19011961, 19013891, 19020750, 19021634, 19025599, 19028704, 19028706, 19035303, 19038001, 19082494, 19082709, 19082882, 19084502, 19088016, 19094228, 19095746, 19112174, 19116762, 19126777, 19130408, 19144873, 19148464, 19151428, 19154418, 19156836, 19159686, 19167446, 19167496, 19190350, 19217708, 19219042, 19224856, 19225135, 19246968, 19250197, 19250200, 19264808, 19267401, 19274700, 19287456, 19289846, 19292896, 19298602, 19305383, 19320640, 19321582, 19323294, 19339517, 19351835, 19351845, 19364822, 19366795, 19367284, 19370415, 19372580, 19381686, 19383343, 19384950, 19396150, 19398483, 19414322, 19414598, 19429437, 19435816, 19487288, 19487384, 19491898, 19496786, 19505923, 19507020, 19509295, 19522736, 19526339, 19567422, 19575750, 19578798, 19584287, 19587092, 19605405, 19628648, 19630952, 19638585, 19651820, 19657672, 19661335, 19671761, 19698761, 19707857, 19718048, 19723326, 19724876, 19729795, 19738052, 19738412, 19739079, 19744330, 19760036, 19771505, 19772891, 19800002, 19801938, 19806012, 19836388, 19838210, 19842031, 19843668, 19847644, 19851860, 19856316, 19859802, 19861523, 19874578, 19875957, 19879889, 19879930, 19895368, 19898421, 19901195, 19903847, 19920189, 19928762, 19935720, 19940156, 19941161, 19943940, 19946260, 19946334, 19956951, 19996302, 20023245, 20025868, 20042638, 20045728, 20061804, 20073617, 20076999, 20079471, 20087860, 20101208, 20101445, 20104523, 20104649, 20116857, 20140701, 20145118, 20146796, 20151319, 20156214, 20156333, 20170107, 20179226, 20179234, 20181721, 20186046, 20197399, 20205715, 20208479, 20213080, 20224929, 20231686, 20234815, 20300827, 20301197, 20305694, 20308691, 2035527, 20370918, 20382698, 20386540, 20388878, 20403033, 20404251, 20410173, 20425602, 20429621, 20431938, 20458558, 20460512, 20460518, 20467919, 20479250, 20482834, 20484105, 20487521, 20490325, 20490651, 20496165, 20501593, 20528735, 20530877, 20531297, 20531310, 20531416, 20547751, 2054780, 20550710, 20551055, 20556506, 20564629, 20569503, 20570586, 20570923, 20577047, 20579400, 20603605, 20604969, 20605569, 20607599, 20608937, 20629094, 20661439, 20664043, 20665103, 20682797, 20683691, 20689759, 20691160, 20696638, 20696891, 20697068, 20699374, 20705611, 20711236, 20711807, 20713855, 20724461, 20724828, 20729066, 20730598, 20734429, 20739888, 20798217, 20805453, 20807815, 20809360, 20817789, 20846920, 20852631, 20858276, 20883782, 20889557, 20889718, 20920219, 20929399, 20934245, 20935677, 20937382, 20945086, 20946668, 20960227, 20966540, 20972617, 20975711, 20978202, 20980149, 21036734, 21059212, 21064098, 21069738, 21078168, 21084382, 21105050, 21108837, 21111561, 21118977, 21120602, 21122099, 21127199, 21129193, 21131358, 21152022, 21156237, 21160418, 21167036, 21167057, 21169420, 21184269, 21184271, 21217774, 21223569, 21226615, 21263130, 21266059, 21266162, 21266827, 21272446, 21273576, 21276249, 21281495, 21289296, 21292820, 21292829, 21297447, 21299862, 2131044, 21326033, 21331623, 21336547, 21338212, 21356271, 21358301, 21362200, 21364760, 21369698, 21378333, 21389782, 21392396, 21406404, 21410323, 21410584, 21425139, 21427553, 21431343, 21435239, 21442356, 21445275, 21447808, 21454576, 21459801, 21477609, 21480222, 21499302, 21509526, 21516302, 21523713, 21524465, 21541704, 21546925, 21552322, 21554733, 21575280, 21593217, 21595884, 21602804, 21607583, 21607585, 21625942, 21641572, 21642474, 21643930, 21655924, 21658239, 21664418, 21677473, 21684697, 21690342, 21705183, 21706157, 21707964, 21713035, 21717460, 21734015, 21737465, 21741601, 21750172, 21755340, 21761348, 21761362, 21765473, 21771784, 21807936, 21812955, 21814749, 21818254, 21821674, 21825015, 21826373, 21852249, 21858728, 21860415, 21868547, 21875255, 21880792, 21887697, 21893353, 21896991, 21900106, 21909982, 21920899, 21924251, 21939527, 21944253, 21946067, 2194831, 21986093, 21988594, 21996731, 22012767, 22026417, 22034498, 22035181, 22042793, 22053771, 22056872, 22060274, 2206558, 2207345, 22074947, 22083956, 22087758, 22094188, 22096658, 22105146, 22112941, 22112967, 22113133, 22124578, 22144499, 22151997, 22157294, 22158035, 22158050, 22170254, 22174013, 22182837, 22199302, 22207555, 22212555, 22227247, 22228098, 22231442, 22234518, 22261811, 22262870, 22266866, 22267197, 22267707, 22270937, 22274890, 22286763, 22291441, 22291950, 22293394, 22301704, 22301780, 22307688, 22322671, 22323552, 22331459, 2233741, 22342541, 22345291, 22348646, 22351618, 22362381, 22367215, 22374518, 22391567, 22399296, 22402113, 22402307, 22404099, 22427054, 22442272, 22446103, 22452962, 22460789, 22464689, 22476901, 22476979, 22480149, 22502712, 22510516, 22515611, 22521644, 22530051, 22543272, 22550166, 22553917, 22558281, 22559974, 22576469, 22576740, 22584640, 22591913, 22596188, 22606272, 22616702, 22617030, 22622808, 22623953, 22626971, 22638694, 22644305, 22644656, 22644675, 22662208, 22673335, 22699783, 22703232, 22705004, 22711074, 22719059, 22723919, 22733972, 22738294, 22747683, 22751110, 22752292, 22771536, 22787161, 22788972, 22791811, 22792352, 22799738, 22799881, 2280770, 22809143, 22810499, 22812573, 22819674, 22820289, 22824300, 22825374, 22844580, 22848668, 22850893, 22855140, 22875649, 22892847, 22907427, 22922440, 22929540, 22947396, 2295073, 22964581, 22965832, 22967435, 22971638, 22975348, 22976474, 22986521, 22992372, 23000059, 23001124, 23001908, 23012411, 23022997, 23023313, 23023562, 23035882, 23045591, 23053664, 23053665, 23054611, 23056300, 23063783, 23064179, 23065001, 23068099, 23071542, 23079576, 23098526, 23109706, 23115015, 23117886, 23124476, 23136140, 23136197, 23142364, 23142699, 23151593, 23159947, 23169272, 23178495, 23178685, 23183268, 23184080, 23184698, 23186136, 23203101, 23216744, 23228987, 23244119, 23248117, 23251644, 23267128, 23268322, 23272245, 23274857, 23284898, 23285017, 23291854, 23319441, 23342133, 23342282, 23344024, 23346221, 23347430, 23374155, 23379261, 23390529, 23391338, 23391903, 23402757, 23403054, 23404426, 23443115, 23448346, 23460808, 23467929, 23468243, 23486015, 23486537, 23499324, 23512947, 23516639, 23518928, 23525242, 23526455, 23530639, 23533663, 23535344, 23535825, 23536962, 23542418, 23547709, 23559098, 23568005, 23588792, 23592700, 23593342, 23598999, 23609471, 23618950, 23635953, 23644255, 23657153, 23664836, 23666105, 23676274, 23679233, 23682072, 23686317, 23686416, 23690508, 23715497, 23723333, 23741969, 23743933, 23744764, 23750285, 23757354, 23758962, 23762395, 23764000, 23764426, 23770244, 23782942, 23786776, 23800221, 23810005, 23810988, 23813010, 23816933, 23817433, 23818839, 23832257, 23839043, 23840656, 23847351, 23857602, 23861345, 23861811, 23868472, 23871935, 23874830, 23885756, 23891847, 23893181, 23894323, 23900261, 23900300, 23909066, 23912957, 23913582, 23914993, 23918832, 23918944, 23923010, 23928990, 23935944, 23945331, 23947965, 23948299, 23951298, 23971947, 23973528, 23977306, 23986557, 23988612, 23991038, 23991131, 23991950, 23996684, 24004841, 24011769, 24019118, 24027428, 24031087, 24043118, 24047697, 24053619, 24058584, 24062209, 24062311, 24068253, 24068539, 24070170, 24071518, 24075202, 24099775, 24100522, 24103091, 24114859, 24121471, 24127041, 24128438, 24130112, 24130769, 24147030, 24147044, 24160266, 24162157, 24166281, 24166501, 24171864, 24185510, 24188694, 24192230, 24201803, 24206214, 24217577, 24218030, 24223763, 24227889, 24258260, 24260416, 24266697, 24270445, 24282978, 24283290, 24289300, 24289631, 24290378, 24290754, 24296488, 24304542, 24305977, 2430688, 24324816, 24325915, 24332559, 24333596, 24335340, 24366407, 24367492, 24367641, 24375531, 24376209, 24377599, 24388359, 24395109, 24398047, 24413532, 24414391, 24425047, 24430361, 24434785, 24440656, 24441042, 24447537, 24447935, 24463007, 24464625, 24464939, 24467828, 24469035, 24469049, 24475217, 24475282, 24481145, 24481326, 24486401, 24486524, 24487689, 24488910, 24495356, 24502950, 24505128, 24510657, 24515104, 24515910, 24520076, 24523857, 24529907, 24534923, 24535190, 24557447, 24583794, 24586797, 24599585, 2460749, 24609850, 24614816, 24615515, 24619425, 24621503, 24634384, 24635704, 24637461, 24637950, 24639548, 24667650, 24670917, 24675476, 24678876, 24684682, 24686172, 24692081, 24713735, 24718280, 24724627, 24735615, 24737323, 24747123, 24747967, 24755315, 24756215, 24758408, 24771346, 24777335, 24780616, 24781337, 24785096, 24786296, 24789043, 24792166, 24803582, 24833090, 24843314, 24852375, 24853384, 24858917, 24866769, 24874954, 24876105, 24885022, 24886537, 24887419, 24891455, 24906430, 24908329, 24910535, 24916694, 24924200, 24928087, 24929094, 24947166, 24960160, 24970479, 24971610, 24971890, 24997853, 25005139, 25007960, 25007965, 25028367, 25048790, 25063027, 25071141, 25072326, 25075030, 25099679, 25100862, 25116933, 25120063, 25127034, 25135164, 25141126, 25151293, 25153034, 25163465, 25168820, 25175082, 25176561, 25178514, 25178713, 25179840, 25201346, 25209432, 25211228, 25218234, 25219498, 25221777, 25227710, 25236687, 2524651, 25258321, 25261645, 25263449, 25266665, 25287073, 25288324, 25292288, 25295793, 25298020, 25307233, 25316285, 25323936, 25327703, 25337220, 25352028, 2535880, 25367875, 25368386, 25370037, 25370469, 25374208, 25388283, 25390939, 25395315, 25410484, 25421376, 25421723, 25450861, 25453096, 25468909, 25476497, 25480943, 25482936, 25488685, 25488809, 25503972, 25524554, 25525332, 25527189, 25531331, 25537643, 25542856, 25586992, 25592378, 25600243, 25606588, 25607819, 25620615, 2562795, 25629224, 25632947, 25633049, 25643697, 25648997, 25652255, 25657113, 25663546, 25680412, 25689428, 25721149, 25725194, 25728338, 25728938, 25730063, 25736597, 25740058, 25740706, 2575000, 25752574, 2576351, 25763854, 25764003, 25770732, 25776849, 25795632, 25801958, 25802405, 25805566, 25816016, 25816324, 25823469, 25833830, 25837259, 25847929, 25848700, 25848915, 25849303, 25855707, 25857627, 25862352, 25871911, 25877889, 25880075, 25881544, 25883093, 25889650, 25901081, 25902832, 25904752, 25917453, 25919761, 25923108, 25927974, 25928008, 25928204, 25940566, 25956506, 25956916, 25962693, 25972244, 25981900, 25981901, 25987214, 25990368, 25991817, 25992689, 25996148, 25998860, 26006730, 26014809, 26022099, 26033813, 26036842, 26046126, 26049107, 26093085, 26096934, 26099425, 26100284, 26100352, 26115764, 26116361, 26117209, 26122040, 26122181, 26124144, 26125274, 26153859, 26158266, 26158350, 26158518, 26160249, 26162914, 26165839, 26166014, 26169690, 26178788, 26179105, 26183823, 26183887, 26184135, 26187699, 26199016, 26201402, 26215677, 26221067, 26232188, 26251034, 26251419, 26261103, 26272591, 26276891, 26277479, 26297734, 26300005, 26320033, 26330541, 26331797, 26351264, 26364613, 26365581, 26383165, 26385458, 26392082, 26392111, 26395027, 26403396, 26404249, 26411678, 26416600, 26426411, 26431674, 26434753, 26434778, 26455641, 26487496, 26492917, 26494790, 26500237, 26515727, 26541420, 26541755, 26552431, 26585129, 26590813, 26598706, 26610607, 26621531, 26621851, 26625804, 26628467, 26645832, 26647383, 26648164, 26650177, 26657878, 26659386, 26670079, 26675256, 26677210, 26681740, 26682542, 26683811, 26695440, 26704768, 26717565, 26740221, 26743380, 26771357, 26795347, 26796263, 26796959, 26801869, 26803986, 26805938, 26810571, 26817629, 26821020, 26834106, 26839307, 26845172, 26846986, 26850117, 26862065, 26883574, 26902609, 26906743, 26909605, 26909792, 26919240, 26920025, 26928228, 26936396, 26937802, 26947176, 26964534, 26971372, 26972162, 26980484, 26980709, 26987290, 27001153, 27005559, 27014911, 27020862, 27023311, 27026707, 27028856, 27029552, 27032101, 27035558, 27043307, 27050076, 27052658, 27053251, 27063095, 27065334, 27070141, 27083183, 27101408, 27105769, 27107895, 27121061, 27121069, 27137076, 27137755, 27141101, 27156566, 27159275, 27175587, 27178332, 27179695, 27181204, 27185370, 27185372, 27187039, 27191888, 27197147, 27213582, 27225751, 27235162, 27246982, 2725532, 27259233, 27260947, 27264933, 27267999, 27269948, 27277684, 27304060, 27312786, 27315045, 27323034, 27340922, 27356714, 27357606, 27365380, 27375289, 27378269, 27380242, 27384237, 27432265, 27449149, 27449292, 27456360, 27464521, 27466487, 2747627, 27487152, 27488105, 27489947, 27490758, 27499099, 27500741, 27508402, 27515002, 2751660, 27525837, 27526056, 27539025, 27539251, 27542969, 27543265, 27548161, 27561704, 27571262, 27573551, 27575406, 27581354, 27593929, 27597141, 27604554, 2761986, 27620280, 27640304, 27681435, 27683176, 27688475, 27689403, 27702820, 27711920, 27712977, 27713477, 27721400, 27729416, 27748765, 27749742, 27753535, 27756582, 27756774, 27758888, 27768589, 27775705, 27779649, 27791031, 27792995, 27793424, 27796716, 27797974, 27809310, 27816721, 27823907, 27825140, 27825388, 27829357, 27832772, 27835577, 27837347, 27841916, 27845892, 2785242, 27853906, 27856629, 27866092, 27870835, 27888136, 27914795, 27921315, 27927249, 27935770, 27935862, 27941878, 27955963, 27959398, 27964748, 27979916, 27981422, 27986439, 27992601, 27993577, 27995352, 28000875, 28005246, 28009468, 28012130, 28028927, 28029147, 28029312, 28035371, 28040694, 28045625, 28049591, 28055972, 28057046, 28060723, 28060751, 28068355, 28069384, 28070831, 28076334, 28079144, 28082280, 28087261, 28096479, 28099174, 28103111, 28103936, 28106301, 28108626, 28112739, 28114999, 28120435, 28131840, 28148690, 28153880, 28159748, 28173783, 28177081, 28177907, 28182136, 28199328, 28209156, 28209621, 28214052, 28215104, 28216037, 28216286, 28221191, 28223545, 28235894, 28236033, 28238967, 28240737, 28243121, 28243897, 28248729, 28249728, 28253895, 28260926, 28263391, 28266545, 28270497, 28270510, 28271747, 28272775, 28274582, 28276317, 28280092, 28281842, 28285967, 28288134, 28296398, 28301080, 28301514, 28301550, 28319069, 28320353, 28322778, 28331366, 28332606, 28334272, 28336670, 28337664, 28341383, 28341599, 28342866, 28344099, 28344890, 28347547, 28348059, 28355428, 28360138, 28362679, 28367091, 28373182, 28374222, 28376175, 28379297, 28382093, 28383555, 28388952, 28396197, 28396978, 28400477, 28412323, 28415602, 28415616, 28416776, 28419445, 28423537, 28423597, 28423635, 28425758, 28427202, 2842775, 28428285, 28432361, 28433540, 28442559, 28454423, 28455002, 28460819, 28463089, 28464832, 28466123, 28467815, 28470951, 28472544, 28472954, 28475868, 28476032, 28481366, 28486103, 28489882, 28490348, 28490933, 28493933, 28498416, 28506582, 28514748, 28515148, 28520140, 28526959, 28529458, 28529618, 28534357, 28534508, 28535794, 28545469, 28565873, 28567703, 28570501, 28573436, 28574279, 28577281, 28577282, 28588725, 28591870, 28595965, 28599421, 28601929, 28607590, 28611039, 28614911, 28618207, 28624063, 28625568, 28632174, 28632792, 28642035, 28643774, 28644496, 28646740, 28657320, 28659298, 28662179, 28667103, 28669713, 28671018, 28687497, 28689363, 28690652, 28696357, 28698102, 28700487, 28705918, 28708432, 28714517, 28714765, 28717100, 28724364, 28724391, 28724435, 28734944, 28744792, 28751448, 28751463, 28755608, 28756535, 28760601, 28761973, 28766214, 28776283, 28779705, 28784863, 28786813, 28789340, 28789417, 28789451, 28799536, 28808484, 28809778, 28810691, 28813638, 28814897, 28825224, 28828583, 28830573, 28831645, 28839265, 28842253, 28844015, 28844711, 28845177, 28845597, 28847747, 28858267, 28869838, 28870904, 28874413, 28875243, 28877752, 28877935, 28881748, 28891935, 28899409, 28901319, 28910567, 28912152, 28916342, 28918115, 28919786, 28927269, 28942113, 28943990, 28947133, 28957356, 28957821, 28961844, 28962900, 28968398, 28968647, 28974548, 28975625, 28977935, 28979134, 28984209, 28988130, 28993511, 28993998, 29021233, 29029116, 29029640, 29031688, 29033607, 29035379, 29036268, 29039577, 29040973, 29045526, 29045530, 29050248, 29051317, 29051735, 29058716, 29069787, 29069872, 29074358, 29078133, 29087485, 29096683, 29100376, 29109797, 29110491, 29128895, 29131020, 29133365, 29137354, 29141994, 29144542, 29146052, 2915647, 29156699, 29157627, 29162724, 29166868, 29168063, 29175422, 29176653, 29180470, 29188531, 29189179, 29192207, 29197120, 29198894, 29202609, 29202611, 29229933, 29230662, 29232439, 29234247, 29234306, 29241890, 29243782, 29254480, 29260362, 29261141, 29263157, 29263188, 29276409, 29278880, 29285606, 29289555, 29291017, 29292214, 29300901, 29312586, 29312618, 29318276, 29326587, 29330437, 29332343, 29339359, 29342211, 29342868, 29343814, 29344249, 29345254, 29348811, 29349448, 29351904, 29352368, 29353824, 29353882, 29360925, 29361175, 29363543, 29368311, 29371858, 29373839, 29375380, 29378668, 29393914, 29401647, 29409530, 29414691, 29416786, 29416796, 29420220, 29433542, 29436614, 29436642, 29436922, 29438688, 29444670, 29451783, 29453314, 29466767, 29467493, 29478216, 29482551, 29483206, 29502324, 29513571, 29518546, 29525735, 29530940, 29541976, 29543921, 29550845, 29553968, 29554462, 29554473, 29557271, 29562737, 29572677, 29574860, 29574992, 29578175, 29587339, 29587674, 29587753, 29588602, 29599329, 29602822, 29614078, 29625565, 29633513, 29636357, 29636363, 29662238, 29665550, 29665866, 29666928, 29673111, 29673760, 29674510, 29678492, 29684479, 29685157, 29687853, 29691722, 29692688, 29700127, 29702197, 29702977, 29707142, 29709338, 29713854, 29718790, 29733910, 29737472, 29738697, 29740030, 29743443, 29745079, 29748621, 29753772, 29759595, 29761323, 29763858, 29763890, 29769099, 29772460, 29772517, 29777335, 29789325, 29802348, 29805656, 29842969, 29843638, 29845295, 29858579, 29873413, 29877575, 29880014, 29885789, 29893332, 29895278, 29895970, 29898754, 29899079, 29901116, 29915250, 29922922, 29928444, 29931061, 29931120, 29934505, 29935166, 29935374, 29935900, 29937544, 29940022, 29945962, 29963233, 29965793, 29970021, 29970713, 29972720, 29973879, 29975948, 29979736, 29987050, 29991605, 29996906, 30006796, 30013390, 30014897, 30019586, 30021371, 30036253, 30038216, 30038716, 30041599, 30042681, 30052783, 30054430, 30054830, 30057418, 30061207, 30087072, 30089255, 30097312, 30102524, 30107476, 30115027, 30120700, 30123125, 30128071, 30128181, 30131927, 30132794, 30133331, 30137688, 30138940, 30143553, 30145202, 30149225, 30151737, 30153467, 30154572, 30155484, 30158597, 30173322, 30175120, 30177834, 30177835, 30177847, 30179118, 30179299, 30180594, 30180878, 30181360, 30183988, 30184043, 30186165, 30190545, 30191958, 30194396, 30195206, 30207238, 30208353, 30208932, 30213797, 30214302, 30218195, 30221739, 30226366, 30226541, 30226592, 30229539, 30229826, 30232064, 30233207, 30241942, 30247957, 30248461, 30252931, 30258538, 30261866, 30262864, 30262900, 30265334, 30277539, 30278072, 30284735, 30286765, 30289755, 30290658, 30293712, 30299291, 30301163, 30301189, 30315000, 30315184, 30315845, 30319540, 30321870, 30324661, 30324876, 30326622, 30326937, 30328006, 30334368, 30338035, 30338425, 30347895, 30358192, 30359738, 30361903, 30365135, 30367332, 30373175, 30373552, 30375428, 30387004, 30388713, 30388728, 30389467, 30391994, 30395264, 30399599, 30404440, 30404658, 30410061, 30411431, 30412247, 30414939, 30415143, 30416383, 30418174, 30430577, 30450577, 30454027, 30463022, 30497079, 30498869, 30500622, 30509329, 30515770, 30519041, 30523750, 30531871, 30532215, 30535478, 30538543, 30542725, 30546460, 30547831, 30558648, 30560461, 30570850, 30573685, 30577860, 30579865, 3058236, 30583472, 30587150, 30587451, 30591472, 30594038, 30597041, 30597111, 30598194, 30604153, 30616080, 30617282, 30620711, 30621641, 30622040, 30631046, 30636932, 30640465, 30642093, 30642351, 30646517, 30647855, 30651078, 30655322, 30655324, 30655757, 30655876, 30655946, 30658681, 30658716, 30659843, 30663337, 30675245, 30675282, 30679303, 30680514, 30687231, 30689838, 30691108, 30694768, 30697064, 30707565, 30716576, 30718918, 30720225, 30733228, 30734152, 30736340, 30737644, 30737679, 30742607, 30760519, 30771221, 30775443, 30777364, 30782165, 30782572, 30783737, 30784287, 30791936, 30796353, 30798422, 30813337, 30813351, 30821186, 30823890, 30824542, 30830488, 30833174, 30833270, 30838840, 30840889, 30842152, 30845378, 30847396, 30848213, 30850489, 30851122, 30851384, 30854047, 30855679, 30857277, 30859501, 30861567, 30862719, 30866861, 30867801, 30869771, 30904591, 30908519, 30915533, 30915662, 30920963, 30921201, 30935371, 30937657, 30939353, 30939535, 30943409, 30944014, 30944027, 30952631, 30954508, 30962496, 30968114, 30968961, 30970003, 30972198, 30978702, 30982901, 30987380, 30995757, 31000690, 31002359, 31007067, 31011629, 31012189, 31028134, 31029427, 31036830, 31038398, 31041737, 31041982, 31054897, 31073170, 31084623, 31087799, 31088482, 31090264, 31092464, 31095738, 31099456, 31100617, 31110002, 31112577, 31113820, 31115881, 31120152, 31120565, 31124298, 31125586, 31129450, 31144206, 31149728, 31152079, 31152137, 31158411, 31166208, 31167163, 31173262, 31175940, 31178825, 31186766, 31187481, 31188645, 31190183, 31190337, 31192530, 31195751, 31197914, 31204155, 31210014, 31210440, 31212042, 31213826, 31219612, 31221824, 31222709, 31231467, 31236323, 31257479, 31260937, 31276668, 31277939, 31281726, 31284080, 31289516, 31297554, 31302113, 31318440, 31319040, 31331001, 31331091, 31336602, 31342369, 31348976, 31358030, 31359833, 31362937, 31367884, 31372638, 31384394, 31385051, 31387918, 31390833, 31395589, 31395685, 31401293, 31402403, 31406251, 31408468, 31409371, 31416135, 31419991, 31427580, 31430979, 31431634, 31440781, 3145027, 31451564, 31452755, 31456186, 31456192, 31463793, 31476594, 31479306, 31502168, 31515643, 31518603, 31531802, 31534012, 31545499, 31545985, 31547956, 31548345, 31551181, 31551256, 31555578, 31559573, 31561604, 31562548, 31562570, 31562808, 31572437, 31574930, 31576449, 31578396, 31588183, 31588558, 31588803, 31590382, 31595691, 31601121, 31601247, 31603096, 31604113, 31605532, 31619506, 31627219, 31636386, 31640622, 31644911, 31647839, 31657853, 31658702, 31665670, 31669227, 31669266, 3167228, 31678519, 31683895, 31686835, 31689473, 31701491, 31708649, 31715186, 31731733, 31732674, 31734822, 31737569, 31746305, 31749762, 31767794, 31769341, 31779655, 31781337, 31786415, 31786857, 31804159, 31807179, 31811486, 31811505, 31812165, 31821370, 31823286, 31838731, 31839155, 31839713, 31842789, 31845230, 3224823, 3290209, 3390830, 3463818, 3502607, 3607757, 3677099, 6288225, 6839301, 7272940, 7272941, 7520350, 7538900, 7577702, 7579493, 7581411, 7607570, 7628351, 7629697, 7646066, 7647336, 7664983, 7669725, 7690042, 7705708, 7708056, 7720671, 7759156, 7812959, 7819270, 7851874, 7861463, 7891714, 7903907, 7913659, 7914825, 7916651, 7922981, 7954259, 7989041, 8043496, 8050081, 8101763, 8157081, 8200909, 8219252, 8219253, 8219254, 8261397, 8261406, 8261407, 8275466, 8314777, 8339250, 8368130, 8419924, 8439515, 8440747, 8443399, 8499331, 8504763, 8512345, 8541224, 8600466, 8603051, 8603400, 8609661, 8614007, 8625307, 8636345, 8649771, 8722747, 8744803, 8758927, 8764133, 8798658, 8813116, 8828492, 8912864, 8919544, 8932874, 8940394, 9010238, 9010317, 9010318, 9010319, 9014838, 9032254, 9044830, 9065812, 9066618, 9067542, 9075708, 9102207, 9103405, 9113991, 9131272, 9131589, 9137083, 9137105, 9158695, 9168006, 9195227, 9199297, 9204213, 9241077, 9247911, 9269899, 9270016, 9276643, 9285694, 9328285, 9359472, 9360842, 9367686, 9371489, 9393947, 9400029, 9409287, 9415404, 9422519, 9436640, 9443393, 9449239, 9449245, 9461476, 9495357, 9513045, 9523727, 9533029, 9538123, 9539249, 9544822, 9558715, 9570831, 9592198, 9628887, 9658402, 9662379, 9673390, 9699871, 9705075, 9706140, 9713824, 9723886, 9731492, 9772278, 9786916, 9790916, 9802619, 9815641, 9815758, 9815968, 9816234, 9816251, 9823320, 9850080, 9852397, 9877030, 9879662, 9889290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17417639, 20104649, 20458558, 20966540, 21501481, 21541733, 22038807, 22174584, 23001124, 24014025, 24185510, 24185512, 25330770, 27580430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	22976474, 29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Diseases	Breast Diseases	BEFREE	1362141, 17417639, 20846920, 25981900		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	16808847, 25542925, 28470951, 34261476	Associate	★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	LHGDN	17417639		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	26183824	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10189892, 10207098, 10330684, 10419456, 10471050, 10497269, 10554161, 10595257, 10595909, 10623650, 10815765, 10835497, 10883885, 10922479, 11056692, 11084868, 11140706, 11141479, 11154267, 11238942, 11278648, 11279242, 11315261, 11331294, 11398888, 11400682, 11410592, 11553815, 11562467, 11597325, 11676856, 11676860, 11682486, 11710964, 11751902, 11779841, 11839580, 11844790, 11857292, 11859072, 11866593, 11879565, 11956627, 12177783, 12208864, 12432273, 12461787, 12473173, 12496244, 12527756, 12527894, 12644823, 12671707, 12705869, 12716463, 12736255, 12750263, 12783932, 12850313, 12853125, 12878861, 12954762, 12960427, 1356959, 1450062, 14507640, 14572667, 14578200, 14580259, 14580261, 14614325, 14661035, 14669271, 14967480, 14970864, 14979917, 14985328, 15016320, 15020841, 15084241, 15084249, 15155736, 15161050, 15169914, 1517234, 15178330, 15182430, 15193262, 15193263, 15203171, 15217512, 15217513, 15220474, 15229223, 15254226, 15255541, 15311216, 15342491, 15470903, 15477865, 15556606, 15557281, 15591335, 15606925, 15619641, 15625066, 15642158, 15642159, 15642162, 15662126, 15692750, 15735025, 15746191, 15762987, 15772083, 15796211, 15798095, 15808510, 15831449, 15898220, 15923424, 15930460, 15965230, 15983032, 15999154, 15999367, 16084894, 16087863, 16107734, 16118406, 16127422, 16141343, 16168103, 16168139, 16219765, 16229810, 16280033, 16280036, 16404153, 16417650, 16417653, 16427018, 16469747, 16475675, 16485008, 16608533, 16622466, 16645043, 16674832, 16679312, 16685445, 16723304, 16737553, 16754886, 16760268, 16769725, 16778215, 16778766, 16791593, 16808847, 16809346, 16827106, 16827122, 16849584, 16859517, 16877730, 16880429, 16880783, 16885352, 16886637, 16899602, 16925584, 16940181, 16965238, 16980581, 16980602, 16996503, 17069650, 17076897, 17078870, 17121430, 17140257, 17143263, 17146782, 17166846, 17189381, 17275994, 17306756, 17311307, 17334408, 17360330, 17384676, 17391528, 17404087, 17407600, 17427198, 17428314, 17440086, 17452776, 17453340, 17463000, 17486653, 17515403, 17525128, 17545528, 17553133, 17555561, 17562079, 17573968, 17575115, 17591366, 17591841, 17591970, 17594514, 17598908, 17599377, 17602054, 17616674, 17617929, 17627304, 17631492, 17683518, 17690249, 17700572, 17710163, 17726259, 17761946, 17848193, 17850661, 17872899, 17883861, 17889406, 17894856, 17897439, 17932744, 17937790, 17986353, 17993718, 17998253, 17998543, 18000219, 18030330, 18059023, 18059161, 18070926, 18072233, 18072234, 18076012, 18079323, 18087590, 18164268, 18167132, 18174157, 18183590, 18211679, 18221536, 18225556, 18226260, 18229450, 18231641, 18254957, 18258689, 18269587, 18271972, 18275596, 18287268, 18317449, 18327670, 18337247, 18350142, 18360352, 18365014, 18379196, 18381931, 18383888, 18386930, 18388150, 18398030, 18405391, 18409071, 18414401, 18425577, 18445275, 18445827, 18467441, 18471979, 18483177, 18483331, 18483465, 18485221, 18493596, 18498629, 18499701, 18507014, 18516291, 18518979, 18521086, 18534028, 18550772, 18563554, 18593943, 18596862, 18628976, 18631401, 18644836, 18645020, 18647968, 1864980, 18665173, 18676847, 18678925, 18690166, 18703630, 18705646, 18708351, 18714337, 18714348, 18720524, 18726992, 18752050, 18752184, 18755890, 18768663, 18769129, 18784357, 18787018, 18790736, 18794799, 18807177, 18813793, 18838536, 18843012, 18922159, 18928543, 18953651, 18957410, 18974123, 18974135, 18984578, 19000652, 19016759, 19025652, 19035289, 19035303, 19036156, 19037733, 19054566, 19074826, 19082460, 19082709, 19084267, 19095746, 19112174, 19117054, 19117995, 19126777, 19169277, 19171042, 19188451, 19190139, 19205871, 19219042, 19221050, 19224362, 19225135, 19238079, 19256737, 19264808, 19270784, 19282383, 19292896, 19298602, 19305383, 19308726, 19320640, 19321582, 19347708, 19351845, 19364822, 19366795, 19367284, 19383343, 19383788, 19396150, 19414322, 19421167, 19433448, 19435893, 19435922, 19436038, 19451819, 19458056, 19460860, 19477949, 19487384, 19491898, 19496786, 19509295, 19528081, 19528477, 19538528, 19549254, 19549328, 19551847, 19563758, 19567422, 19569049, 19574173, 19574486, 19575750, 19584327, 19596702, 19605405, 19609101, 19619298, 19620238, 19630952, 19631337, 19636371, 19652226, 19659610, 19660128, 19661335, 19700746, 19706389, 19711044, 19723326, 19729795, 19730444, 19734850, 19738052, 19738412, 19740422, 19749156, 19762336, 19799643, 19800460, 19800873, 19808870, 19819143, 19821643, 19826002, 19828073, 19839584, 19843668, 19844788, 19861523, 19882362, 19887647, 19898421, 19898422, 19902352, 19902354, 19920189, 19925796, 19933843, 19935720, 19940364, 19943940, 19946260, 19946334, 19955335, 19969081, 20026902, 20035625, 20043081, 20044602, 20061804, 20065188, 20068169, 20079471, 20080953, 20086172, 20101208, 20104649, 20109227, 20117934, 20124184, 20130088, 20132222, 20140702, 20154269, 20156214, 20156333, 20156340, 20173733, 20180843, 20197399, 20208560, 20210488, 20211987, 20219941, 20228224, 20234184, 20234815, 20237034, 20308691, 20334372, 20346095, 20348243, 2035527, 20370918, 20382698, 20383761, 20388878, 20392877, 20395295, 20412544, 20421265, 20457620, 20459607, 20460512, 20462604, 20471474, 20479250, 20482834, 20482849, 20487521, 20495533, 20498993, 20501593, 20509143, 20515469, 20516217, 20524616, 20531416, 20543978, 20547751, 20564629, 20569503, 20571172, 20579400, 20581046, 20602252, 20603432, 20604969, 20619646, 20629078, 20629094, 20631257, 20661439, 20663877, 20664923, 20678512, 20682797, 2068513, 20696638, 20697068, 20705559, 20705611, 20720010, 20818337, 20826546, 20837693, 20846786, 20846920, 20852631, 20858276, 20863372, 20878674, 20889557, 20889718, 20920219, 20946668, 20956553, 20966540, 20974640, 20975711, 20979617, 21040551, 21041310, 21059815, 21062454, 21080930, 21084382, 21087932, 21092082, 21092257, 21108837, 21118977, 21119029, 21131358, 21145356, 21151129, 21152022, 21152357, 21167036, 21167057, 21184265, 21191117, 21194473, 21203526, 21209903, 21212417, 21223569, 21231986, 21235772, 21247819, 21263059, 21264507, 21269472, 21272446, 21281495, 21292829, 21304180, 21305539, 21310761, 21315410, 21321311, 21321422, 21346144, 21346806, 21356353, 21362200, 21363879, 21364029, 21364760, 21367855, 21389782, 21390186, 21392396, 21402692, 21410323, 21422407, 21430657, 21432907, 21442356, 21454829, 21459801, 21472707, 21492444, 21499302, 21505052, 21512034, 21523713, 2153347, 2153668, 21536917, 21541704, 21546925, 21552322, 21554733, 21558518, 21564419, 21572391, 21575280, 21592345, 21593217, 21595894, 21596782, 21617856, 21625942, 21627355, 21652577, 21655754, 21655924, 21658239, 21666713, 21670145, 21671470, 21680658, 21693539, 21695171, 21700456, 21707964, 21709197, 21711071, 21713035, 21720988, 21729671, 21737614, 21738574, 21738599, 2174894, 21753181, 21754991, 21761334, 21761348, 21761362, 21761367, 21777924, 21789246, 21790896, 21791674, 21792626, 21795498, 21818254, 21819166, 21821674, 21825015, 21826373, 21826535, 21835891, 21841772, 21844186, 21852249, 21860415, 21865043, 21868451, 21887591, 21896991, 21897387, 21900106, 21903739, 21914172, 21917182, 21922275, 21924251, 21925980, 21939527, 21940501, 21947652, 21947828, 2194831, 21951600, 21956102, 21976967, 21978374, 21982568, 21984977, 21986093, 21999244, 22002538, 22010013, 22012767, 22015617, 22026417, 22037553, 22053771, 22053997, 22074947, 22080730, 22081245, 22083956, 22084256, 22093364, 22116632, 22125492, 22128190, 22129357, 22132214, 22138097, 22138580, 22139072, 22142239, 22151962, 22151997, 22168360, 22173289, 22174013, 22198676, 22212555, 22216287, 22228098, 22238615, 22240506, 22241912, 22245973, 22249250, 22251451, 22262870, 22274868, 22274890, 22279038, 22282662, 22291950, 22298467, 22301704, 22313737, 22319200, 22320227, 22331459, 22345290, 22347418, 22348324, 22351618, 22359236, 22359603, 22362381, 22363779, 22366170, 22374580, 22375075, 22383897, 22399296, 22404099, 22417809, 22418568, 22426783, 22429491, 22431515, 22433870, 22436383, 22446103, 22447278, 22452962, 22457607, 22457730, 22461340, 22480149, 22492511, 22498909, 22502712, 22508765, 22510516, 22524805, 22524806, 22532573, 22533360, 22537114, 22543272, 22553917, 22559056, 22576469, 22584640, 22596188, 22606272, 22608253, 22621334, 22622808, 22623953, 22626971, 22638694, 22644675, 22662208, 22669764, 22706628, 22713214, 22723919, 22733972, 22747683, 22752290, 22767585, 22773826, 22787161, 22788972, 22792175, 22792352, 22799290, 22799305, 22799344, 22799881, 22815861, 22835548, 22835918, 22842983, 22850893, 22859400, 22859439, 22865780, 22892847, 22895181, 22898337, 22899286, 22903686, 22905241, 22918168, 22918549, 22922440, 22929540, 22931685, 22933044, 22935699, 22961301, 22964432, 22964581, 22967435, 22971289, 22972694, 22975761, 22976807, 22986510, 23001124, 23001908, 23022996, 23023562, 23028062, 23028573, 23033157, 23049873, 23049944, 23053665, 23054611, 23056300, 23060440, 23065768, 23096432, 23098526, 23109706, 23112837, 23128390, 23133541, 23133636, 23134758, 23145928, 23149465, 23153126, 23159947, 23169992, 23172872, 23175448, 23178685, 23188436, 23196318, 23211940, 23213055, 23216744, 23216985, 23222412, 23226206, 23233354, 23242584, 23244119, 23250869, 23251644, 23271326, 23274857, 23284037, 23285017, 23288344, 23301057, 23322423, 23339407, 23342072, 23342080, 23342282, 23346221, 23347430, 23354978, 23368093, 23368971, 23373633, 23374155, 23382923, 23390529, 23391338, 23391903, 23392859, 23401605, 23435732, 23436375, 23436777, 23448346, 23451128, 23474223, 23486537, 23493347, 23497452, 23499324, 23505378, 23518928, 23535733, 23535825, 23542176, 23547709, 23549681, 23558572, 23558933, 23559098, 23563506, 23565824, 23568563, 23576735, 23579816, 23585185, 23588952, 23593250, 23593342, 23598999, 23626833, 23629941, 23636943, 23643682, 23663560, 23676274, 23679233, 23681011, 23686416, 23701942, 23704778, 23706161, 23709174, 23715497, 23718638, 23722551, 23723241, 23723333, 23741969, 23743933, 23750285, 23758675, 23762395, 23764000, 23770244, 23774759, 23781139, 23782942, 23786776, 23801158, 23811274, 23812730, 23816933, 23817696, 23818839, 23819905, 23826382, 23828038, 23839043, 23844228, 23857602, 23861811, 23867982, 23873416, 23874830, 23875016, 23882126, 23885756, 23886210, 23893181, 23894323, 23902710, 23907597, 23912957, 23913682, 23914993, 23918832, 23922822, 23922954, 23923010, 23942918, 23948299, 23951298, 23957561, 23965901, 23970364, 23971947, 23992566, 23996684, 24000936, 24008056, 24027428, 24029245, 24043118, 24047697, 24051437, 24053619, 24058649, 24060333, 24066170, 24068038, 24070170, 24072219, 24086693, 24096540, 24098477, 24101215, 24103091, 24114857, 24118529, 24125069, 24127041, 24147044, 24152184, 24160266, 24163404, 24171864, 24185510, 24192230, 24205071, 24218030, 24225485, 24239807, 24244489, 24260416, 24265353, 24265722, 24266697, 24270600, 24283290, 24284485, 24288367, 24289300, 24289629, 24290378, 24297604, 24304542, 24304549, 24309997, 24312637, 24321102, 24333426, 24337596, 24339902, 24347518, 24367492, 24367641, 24368439, 24371278, 24372669, 24373320, 24388359, 24391143, 24398047, 24403250, 24412361, 24412525, 24413080, 24414130, 24422630, 24430361, 24434785, 24441041, 24441042, 24449868, 24456584, 24462521, 24467828, 24469035, 24470138, 24475282, 24481062, 24481145, 24485087, 24486401, 24486524, 24487688, 24488910, 24495356, 24496634, 24501006, 24502950, 24505128, 24505287, 24510657, 24515104, 24520381, 24523857, 24525703, 24528085, 24534923, 24549642, 24552459, 24557447, 24559156, 24563630, 24565120, 24574065, 24584939, 24587767, 24588102, 24591826, 24598415, 24599585, 24604139, 24606469, 24612502, 24614816, 24618835, 24619425, 24622579, 24634376, 24639548, 24641868, 24651077, 24656476, 24663045, 24667650, 24669750, 24678876, 24686172, 24695361, 24718280, 24718936, 24721635, 24727858, 24731990, 24742914, 24747123, 24755315, 24758297, 24758408, 24762482, 24771004, 24777335, 24785096, 24788909, 24789043, 24792166, 24815444, 24815488, 24816718, 24833090, 24839032, 24850180, 24853384, 24858917, 24865188, 24870798, 24879526, 24885022, 24886537, 24887359, 24887419, 24887554, 24905577, 24906430, 24908329, 24911119, 24914205, 24916694, 24919951, 24931973, 24934762, 24947166, 24951027, 24954507, 24962896, 24970479, 24971511, 24971610, 24971890, 24973012, 24979764, 24996432, 25003827, 25004928, 25005139, 25010932, 25011585, 25027393, 25047707, 25048790, 25064027, 25069039, 25070479, 25081647, 25081661, 25082024, 25101695, 25106495, 25111287, 25116933, 25122196, 25124606, 25140630, 25145671, 25148458, 25168820, 25174527, 25178514, 25179838, 25190451, 25193543, 25193864, 25199565, 25201346, 25211228, 25213081, 25221777, 25227710, 25228414, 25240289, 25242450, 25258390, 25261645, 25269750, 25283589, 25287328, 25288324, 25295793, 25298020, 25300391, 25307233, 25323936, 25327703, 25336146, 25336660, 25337220, 25338319, 25352523, 25360542, 25362932, 25363786, 25370037, 25373603, 25374208, 25388283, 25390939, 25395315, 25409762, 25410484, 25412710, 25420785, 25421376, 25422431, 25424702, 25450264, 25476497, 25486199, 25488685, 25488809, 25503972, 25542925, 25556893, 25560734, 25582774, 25583948, 25586992, 25592378, 25592575, 25607819, 25613123, 25625755, 25633049, 25640367, 25644501, 25648997, 25652398, 25663546, 25664859, 25666264, 25682200, 25683269, 25701261, 25706943, 25721149, 25725194, 25725373, 25728938, 25730063, 25740706, 25752574, 25755795, 25756514, 25763854, 25764003, 25771071, 25776849, 25787708, 25788266, 25802405, 25808624, 25820259, 25829806, 25838462, 25844937, 25848700, 25849221, 25849303, 25855707, 25857409, 25860340, 25861752, 25862352, 25866209, 25867603, 25871911, 25872415, 25880075, 25880212, 25881544, 25885472, 25885960, 25889650, 25896421, 25907805, 25919761, 25923108, 25927974, 25928008, 25929808, 25956506, 25956916, 25961581, 25962693, 25971960, 25974664, 25992689, 25993174, 25994573, 25996148, 25999793, 26006730, 26014809, 26021831, 26022099, 26026468, 26027929, 26033813, 26041687, 26053183, 26056290, 26073781, 26087699, 26091472, 26093085, 26099425, 26100274, 26100352, 26112049, 26112140, 26115764, 26117209, 26122040, 26141719, 26142905, 26158518, 26160249, 26161666, 26163622, 26165839, 26166704, 26169690, 26177331, 26178079, 26178788, 26179105, 26183823, 26183824, 26206152, 26215677, 26219409, 26230371, 26232141, 26233757, 26235388, 26247365, 26261103, 26266392, 26272591, 26280373, 26280679, 26300005, 26303031, 26313461, 26317216, 26319120, 26330482, 26339363, 26340863, 26350565, 26378038, 26384297, 26385458, 26392082, 26397135, 26411678, 26426411, 26437901, 26438844, 26439695, 26456774, 26458489, 26467036, 26487496, 26488768, 26490514, 26492917, 26495758, 26496360, 26500237, 26502914, 26514283, 26515727, 26522726, 26541420, 26554417, 26556708, 26560360, 26563128, 26586665, 26590813, 26598706, 26598755, 26610382, 26610383, 26618344, 26621833, 26621851, 26650177, 26657294, 26657878, 26659386, 26660119, 26661278, 26666173, 26681084, 26682542, 26700205, 26703694, 26704768, 26705260, 26706833, 26708273, 26711786, 26717565, 26718772, 26722530, 26739972, 26743380, 26763249, 26771357, 26783290, 26796959, 26797453, 26801869, 26812885, 26821020, 26823864, 26829108, 26836308, 26845172, 26849233, 26850117, 26850484, 26850786, 26862065, 26887643, 26899418, 26909605, 26919240, 26920143, 26927093, 26937933, 26959415, 26960573, 26964534, 26970359, 26970778, 26972162, 26976426, 26980709, 26986571, 26999003, 26999742, 27001563, 27002480, 27005559, 27014911, 27017931, 27023311, 27028856, 27029768, 27029813, 27032101, 27034161, 27041579, 27043307, 27049344, 27050076, 27059031, 27062924, 27067054, 27093453, 27102299, 27105516, 27107013, 27121061, 27129152, 27129269, 27141101, 27144536, 27149453, 27156566, 27159275, 27167193, 27174596, 27178176, 27178332, 27185372, 27197157, 27217450, 27221883, 27224909, 27228187, 27246191, 27269948, 27270325, 27277684, 27285752, 27287781, 27294610, 27301701, 27304060, 27308830, 27312786, 27315045, 27317095, 27323688, 27325688, 27334837, 27351134, 27353038, 27356714, 27368476, 27375289, 27378269, 27380242, 27384485, 27388210, 27389414, 27400969, 27402876, 27448983, 27456360, 27477822, 27483141, 27485598, 27489360, 27491861, 27498697, 27502118, 27515002, 27525837, 27526056, 27532364, 27535130, 27538498, 27539025, 27539783, 27542969, 27543265, 27551012, 27556158, 27571262, 27580430, 27599752, 27612429, 27619909, 27628678, 27640304, 27650678, 27662272, 27666119, 27672107, 27689403, 27702820, 27706044, 27708239, 27713164, 27713477, 27717337, 27737921, 27748765, 27753529, 27753535, 27756582, 27758888, 27760283, 27764788, 27764800, 27775837, 27788154, 27796716, 27801670, 27806114, 27821721, 27825388, 27829357, 27831634, 27835900, 27836010, 27845892, 27848153, 27853906, 27856629, 27869171, 27923781, 27926517, 27926873, 27926932, 27927249, 27959398, 27964748, 27966906, 27979916, 27986439, 27992601, 27993329, 27997592, 28009468, 28027327, 28029312, 28030809, 28045625, 28055379, 28057031, 28068325, 28068434, 28076334, 28079144, 28086982, 28106823, 28108260, 28108626, 28112739, 28122895, 28127872, 28167798, 28173783, 28174300, 28178648, 28192639, 28199328, 28211214, 28215104, 28216286, 28223545, 28241804, 28244460, 28253895, 28262792, 28263985, 28270497, 28270510, 28276460, 28306507, 28320353, 28332571, 28332606, 28353608, 28388952, 28400477, 28404930, 28404972, 28415819, 28416489, 28419166, 28423537, 28423635, 28427202, 28429243, 28432361, 28464832, 28467815, 28468300, 28472544, 28475868, 28486103, 28489509, 28490348, 28507152, 28514748, 28521362, 28534357, 28577081, 28577282, 28591870, 28625568, 28632792, 28637868, 28643021, 28643022, 28643774, 28657320, 28662179, 28670784, 28679775, 28692043, 28702894, 28712835, 28714765, 28730340, 28747642, 28756535, 28761624, 28761973, 28791495, 28794284, 28795252, 28799536, 28805661, 28808806, 28809778, 28819152, 28825224, 28852212, 28854070, 28869838, 28877752, 28886093, 28887413, 28891017, 28901319, 28912144, 28935545, 28945887, 28957356, 28961844, 28968398, 28972307, 28973975, 28984209, 28985022, 28985473, 29029116, 29029636, 29029640, 29039577, 29045526, 29058716, 29063679, 29109797, 29110491, 29116467, 29128895, 29128898, 29131020, 29133365, 29133514, 29138345, 29141657, 29143794, 29157627, 29162134, 29162724, 29162888, 29166868, 29178616, 29180470, 29187727, 29192207, 29207087, 29212519, 29212847, 29232439, 29237009, 29243084, 29243782, 29246124, 29260362, 29269484, 29278880, 29286917, 29289986, 29302853, 29304773, 29306943, 29309250, 29309722, 29315403, 29320557, 29330437, 29330934, 29331414, 29339359, 29339455, 29342901, 29353883, 29357906, 29360925, 29362861, 29363090, 29370782, 29371476, 29371858, 29373839, 29378668, 29409530, 29436583, 29436642, 29436922, 29438688, 29445914, 29447503, 29450494, 29451783, 29453409, 29462880, 29462945, 29482551, 29522266, 29528718, 29531247, 29541976, 29543921, 29550845, 29553968, 29573739, 29584547, 29590154, 29602822, 29614078, 29615116, 29618179, 29620220, 29620287, 29662198, 29665866, 29669860, 29674510, 29680858, 29682089, 29687853, 29689710, 29695586, 29698439, 29700127, 29720215, 29738694, 29739819, 29739933, 29743060, 29743443, 29745079, 29748621, 29769099, 29779937, 29789325, 29790386, 29795261, 29802348, 29804556, 29843638, 29848291, 29858579, 29861831, 29880014, 29880033, 29893332, 29901116, 29902286, 29921289, 29945225, 29949531, 29965997, 29970713, 29972720, 29973242, 29974997, 29979736, 29987050, 29991699, 29996866, 30013179, 30036253, 30038216, 30041599, 30078824, 30087366, 30089255, 30091186, 30097312, 30103729, 30104333, 30119678, 30129697, 30137688, 30143015, 30145202, 30154572, 30158597, 30161001, 30177847, 30180878, 30185547, 30190545, 30191958, 30192170, 30208353, 30208932, 30226366, 30226541, 30229539, 30248461, 30270031, 30278072, 30278449, 30285883, 30286765, 30286806, 30289978, 30296589, 30301189, 30304110, 30305115, 30327501, 30334368, 30342538, 30343527, 30351173, 30352569, 30355675, 30358191, 30373552, 30375428, 30387004, 30388713, 30391994, 30404440, 30404658, 30407916, 30419347, 30420728, 30430768, 30431262, 30450766, 3045126, 30451357, 30457555, 30458661, 30458882, 30463022, 30472020, 30489256, 30497079, 30534999, 30543347, 30554720, 30560461, 30563991, 30570850, 30573685, 30579865, 30587150, 30591548, 30595381, 30597041, 30597111, 30613307, 30616080, 30621641, 30631150, 30642363, 30645633, 30646864, 30648747, 30649385, 30651078, 30655322, 30655324, 30663337, 30665944, 30680659, 30722113, 30736096, 30736836, 30737679, 30742607, 30760083, 30795773, 30796653, 30813351, 30816325, 30837324, 30841783, 30857277, 30860570, 30860573, 30862719, 30866472, 30866861, 30875375, 30908519, 30915533, 30920963, 30937657, 30943409, 30944027, 30944316, 30951390, 30982901, 30988301, 30995757, 31019021, 31028134, 31059536, 31060537, 31063232, 31066241, 31073170, 31084623, 31099456, 31110002, 31112577, 31117836, 31120565, 31121213, 31124293, 31124298, 31138829, 31146345, 31151151, 31152079, 31167163, 31169691, 31171849, 31189691, 31199586, 31211741, 31229512, 31257479, 3128508, 31295870, 31307414, 31319040, 31329371, 31358030, 31362937, 31371343, 31372638, 31372841, 31410192, 31426673, 31431634, 31439820, 31476594, 31501276, 31506431, 31506496, 31527615, 31535320, 31536495, 31540491, 31551256, 31562808, 31578396, 31588232, 31601247, 31605532, 31635050, 31640597, 31640622, 31655316, 31657150, 31665365, 31675993, 31684907, 31708649, 31710162, 31731733, 31733575, 31742342, 31757843, 31760402, 31786857, 31789400, 31801599, 31809240, 31827114, 31839155, 31856858, 3186693, 31869767, 31883437, 31888550, 31891807, 31894641, 31897900, 31907749, 31911546, 31917424, 31918322, 31924700, 31930332, 31949157, 31949161, 31959227, 31990579, 31996744, 32014063, 32035111, 32036684, 32037484, 32044879, 32046756, 32046997, 32047236, 32066877, 32088792, 32091585, 32097092, 32115800, 32115850, 32120995, 32129154, 32132580, 32143514, 32160387, 32164162, 32168782, 32232341, 32236827, 32241303, 32243901, 32255732, 32265480, 32285914, 32295865, 32298374, 32312891, 32314924, 32319562, 32321078, 32321829, 32326116, 32331421, 32344635, 32348852, 32357920, 32358373, 32365829, 32372569, 32374727, 32381587, 32393308, 32408555, 32408897, 32420379, 32427313, 32429997, 32430679, 32435229, 32445323, 32455774, 32456253, 32466779, 32471192, 32484822, 32489268, 32502940, 32506995, 32512508, 32513126, 32521854, 32543775, 32548262, 32549765, 32554602, 32562536, 32566676, 32569215, 32591490, 32591580, 32592349, 32599554, 32601800, 32603024, 32609836, 32620123, 32620918, 32629869, 32633764, 32650578, 32663742, 32681091, 32684154, 32707076, 32707446, 32716908, 32727562, 32747956, 32753546, 32767328, 32785646, 32807212, 32808350, 32811538, 32816914, 32839427, 32846884, 32894276, 3290209, 32926435, 32929382, 32929565, 32940689, 32956836, 32985495, 32987507, 33008805, 33011748, 33046784, 33053908, 33064289, 33096318, 33101542, 33112819, 33117280, 33117284, 33125139, 33159119, 33164013, 33166784, 33176622, 33176848, 33177647, 33184106, 33184109, 33186740, 33193348, 33198768, 33205346, 3321071, 33247680, 33250473, 33263939, 33278648, 33280520, 33302456, 33307492, 33342777, 33371906, 33386585, 33393037, 33407744, 33413654, 33432018, 33461170, 33464691, 33465101, 33466512, 33468559, 33475714, 33492282, 33494814, 33513026, 33517609, 33545761, 33547330, 33558657, 33566819, 33582945, 33593922, 33602273, 33627502, 33632156, 33688723, 33692409, 33734613, 33763657, 33771975, 33772001, 33782032, 33783288, 33797884, 33799807, 33805656, 33806648, 33813685, 33827682, 33854152, 33861751, 33877311, 33878879, 33894309, 33903732, 33923732, 33926515, 33927073, 33937624, 33950817, 33960684, 33975551, 33977073, 33990400, 34021071, 34042955, 34047951, 34048732, 34049982, 34050358, 34057127, 34059020, 34086424, 34097174, 34101078, 34102222, 34105210, 34113011, 34130640, 34146382, 34146516, 34158394, 34209871, 34215221, 34215580, 34244052, 34244855, 34257555, 34261476, 34268929, 34282517, 34289100, 34299224, 34302605, 34304004, 34320204, 34371382, 34373577, 34391399, 34392135, 34392603, 34406386, 34408238, 34433666, 34440755, 34446451, 34452998, 34464510, 34471053, 34480095, 34481367, 34499316, 34518541, 34537675, 34555047, 34556523, 34572047, 34581028, 34602561, 34610807, 34614512, 34635011, 34677264, 34689714, 34707101, 34711683, 34714340, 34717148, 34725332, 34751852, 34768935, 34779146, 34779498, 34783649, 34792178, 34793665, 34795642, 34803163, 34816585, 34831091, 34841688, 34845227, 34864989, 34866317, 34880202, 34886806, 34896002, 34898327, 34903452, 34904415, 34910326, 34919666, 34930150, 34932597, 34942685, 34944559, 34948163, 34957309, 34958060, 34961764, 34965950, 34983606, 35006257, 35011267, 35011656, 3501245, 35014681, 35017776, 35020071, 35035775, 35065426, 35078818, 35080871, 35084436, 35092367, 35093083, 35093383, 35110502, 35119458, 35121200, 35121623, 35132960, 35135604, 35143945, 35148282, 35151276, 35179782, 35184150, 35201661, 35231585, 35254385, 35263321, 35264224, 35294039, 35298675, 35304506, 35305101, 35321515, 35348781, 35360070, 35370244, 35379053, 35392925, 35394865, 35396981, 35401937, 35418303, 35440136, 35440541, 35468719, 35476451, 35476550, 35499193, 35501367, 35511874, 35541896, 35554533, 35575456, 35579936, 35580079, 35581229, 35583555, 35584336, 35587322, 35605014, 35618789, 35628441, 35648695, 35653148, 35654312, 35654829, 35657638, 35671075, 35672854, 35680375, 35681031, 35684480, 35705040, 35711896, 35729220, 35729304, 35732909, 35757841, 35761208, 35778844, 35779786, 35780210, 35792080, 35793834, 35806196, 35840573, 35842534, 35843886, 35850772, 35862394, 35872983, 35881485, 35886011, 35886868, 35887187, 35897675, 35912728, 35920686, 35947687, 35950920, 35950923, 35959983, 35966598, 36001652, 36006984, 36008376, 36010586, 36040381, 36041543, 36043530, 36048167, 36056637, 36077333, 36124682, 36139419, 36187129, 36192404, 36198774, 36215125, 36221793, 36222718, 36232400, 36232636, 36232774, 36233194, 36239933, 36252018, 36270909, 36271315, 36280829, 36303253, 36318267, 36326669, 36332363, 36335747, 36344993, 36359853, 36384125, 36395883, 36401732, 36410675, 36418319, 36429038, 36436079, 36441548, 36446041, 36460099, 36463275, 36469363, 36484686, 36493359, 36508355, 36516775, 36524361, 36565897, 36578092, 36583834, 36595552, 36626159, 36641651, 36647722, 36647876, 36653923, 36677847, 36768147, 36769215, 36788086, 36795405, 36809469, 36821125, 36826152, 36826464, 36828916, 36831182, 36835157, 36835458, 36856111, 36856112, 36864445, 36867680, 36882618, 36902278, 36925195, 36930833, 36968228, 36977973, 36982173, 36988307, 37009655, 37016301, 37041481, 37070323, 37070653, 37105452, 37106324, 37115435, 37141550, 37143115, 37148752, 37172090, 37180578, 37188449, 37198482, 37222874, 37224961, 37226020, 37244387, 37252969, 37257767, 37260292, 37261814, 37272757, 37298307, 37310740, 37337448, 37341140, 37348019, 37363949, 37395734, 37400769, 37404090, 37406289, 37438515, 37439680, 37443749, 37458145, 37468002, 37483962, 37491786, 37495653, 37501682, 37511178, 37520743, 37524698, 37524746, 37566008, 37591784, 37647069, 37653831, 37673071, 37684569, 37686099, 37688505, 37705026, 37711168, 37725704, 37728466, 37740403, 37746948, 37759508, 37773865, 37776423, 37779428, 37784176, 37803002, 37828053, 37834026, 37854018, 37873865, 37883178, 37888299, 37889058, 37897495, 37902007, 37905439, 37906431, 37914699, 37921419, 37922573, 37964967, 37981011, 37999751, 38007055, 38017133, 38021219, 38048919, 38049758, 38052873, 38060195, 38062011, 38072513, 38072514, 38082224, 38114755, 38122900, 38124592, 38132099, 38136668, 38153734, 38167641, 38231165, 38236307, 38238761, 38254989, 38259466, 38266623, 38266771, 38423186, 38427931, 38429368, 38503615, 38517892, 38527495, 38564418, 38564683, 38599157, 38631690, 38641451, 39178760, 39184142, 39187318, 39187368, 39191497, 39193850, 39201419, 39207954, 39232441, 39275851, 39289642, 39339466, 39342926, 39380101, 39468555, 39512757, 39593108, 39613672, 39684741, 39684756, 39738567, 39742369, 39749373, 39754401, 39780930, 39786405, 39828494, 40054585, 40055794, 40076662, 40101318, 40158122, 40170597, 40227228, 40243758, 40247433, 40300005, 40306187, 40341770, 40345424, 40369345, 40378044, 40392928, 40419887, 40448123, 40466434, 40514718, 40527014, 40534514, 40536266, 40540322, 40594685, 40597935, 40598566, 40604083, 40632306, 40707929, 40708058, 40724972, 7117052, 7149814, 7542977, 7629160, 7686909, 7891714, 7929425, 8195246, 8284222, 8314777, 8334681, 8390284, 8600466, 8647858, 8669476, 8986764, 9032254, 9094987, 9113991, 9137083, 9137105, 9168007, 9271411, 9405430, 9422519, 9461476, 9510472, 9523727, 9545345, 9570831, 9618523, 9632722, 9706140, 9713824, 9738013, 9786916, 9804832, 9831541, 9837972, 9889290	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	11438468, 11860308, 17263897, 18632687, 19385968, 19799609, 20023245, 22144499, 23172894, 23208506, 24427357, 25292074, 25823469, 26186233, 26472563, 27340922, 28196134, 28367091, 30373175, 31504407, 33112117, 34732713, 36505421	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19094228, 19410462, 19458043, 20665103, 23725143, 24637950, 25188383, 26271749, 28470951, 29673111, 30229826, 31062858, 31817155, 32453636, 33112958, 34736510, 37469520, 39242688	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	19442295, 1949915, 22765268, 23096432, 26434893, 26960396, 27765917, 28350011, 29092024, 29396493, 30577860, 32929565, 38369186	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	26313461	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms, Male	Neoplasm of male breast	LHGDN	14973390		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms, Male	Neoplasm of male breast	BEFREE	17592676		★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	20962747		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	16522460		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	24282178		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	29745079	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	22053771	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10835496, 15923424, 18021179, 18317449, 19117995, 20383761, 22291950, 24114184, 24671226, 25534230, 26087699, 26100352, 26301798, 26413526, 27041579, 27516190, 28410230, 29109797, 31744881, 32503542, 33977073, 34234737, 34793665, 34898327, 35014681, 35735430, 8644852, 8876210	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	40362654	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10066068, 10419456, 10713685, 10861509, 11504836, 12045715, 12730870, 15183540, 15623657, 15642159, 15679420, 16021574, 16166291, 16211220, 16675566, 16867866, 17317819, 17448017, 17626182, 17663001, 19170207, 19549254, 20371687, 20458558, 20581058, 20944121, 21276249, 22264274, 22819674, 23001506, 23186136, 23222490, 23923078, 24756215, 24891455, 25592200, 25828708, 26092192, 26141719, 26266392, 27488105, 27681435, 27848152, 28087261, 28582344, 28843711, 28865492, 28945747, 29523126, 29549911, 29565181, 29755131, 29851704, 30060844, 30351173, 30607556, 3084069, 3463818, 7084938, 7496840, 7891714, 7919121, 8244574, 8491760, 8918973, 9266239, 9706140, 9815973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	15637090, 17173897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35476550	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	16080559, 16280033, 19762336, 21091847, 22316048, 22524806, 23535842, 25357113, 26319120, 26690243, 26884359, 27501955, 28765906, 28901319, 30423024, 30633152, 30913871, 32609836, 33263939, 33302909, 33443130, 35051228, 37143728	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	16280033, 17545528, 18225556, 20712900, 24586570, 34001017, 34440755, 37710198	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	30905927	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	21709441, 22295150, 24335662, 24495253, 24684970, 26252518, 26299454, 26330482, 26830028, 28264438, 28832070, 30479097, 30584245, 33416213	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	23962610	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26431491	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12879470, 16757575, 17191310, 20165882, 20383761, 21712254, 25198130, 26122040, 26413526, 26804600, 27899088, 28579181, 29085224, 29286617, 29358876, 29563759, 29962817, 30092792, 32334468, 33656238, 33672651, 33941198, 34050704, 34145394, 34238253, 34787087, 35720901, 35872841, 36351994, 39849382	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34592904	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40148834	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	35123772	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	40362654	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	11839580, 15696127, 16596655, 18769130, 19383825, 22252842, 23752191, 23774990, 23778411, 24634376, 24671226, 26769139, 26884359, 27116088, 27498697, 30190195, 30383678, 31427558, 33263939, 33727261, 34001017, 37870954, 40101158	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	12942575, 24596378	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	17239264, 21126378, 24425047, 27650553, 30228172, 30423024, 30796653, 31229512, 33947745, 35051228, 39256827, 40681988, 9137083	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	20423478, 26266392, 38631690	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	33923191	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	34343231	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24148819, 25277204, 27092883, 29567231, 30511377, 30737158, 31455760		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	24604205, 29274403		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10435640, 11911952, 15161576, 15986439, 16603640, 18949413, 21498706, 22985911, 23608817, 23696246, 25277535, 26301798, 27572263, 28693248, 28783064, 29233790, 30684567		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	20625818, 22765268, 23096432, 23468243, 24970679, 26276719, 27765917, 28350011, 28577471, 29092024, 29478945, 30368484, 30558615, 30577860		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	10960636, 17575226, 20056644, 22652558, 22970307, 24376209, 25243473, 25476534, 29187928, 34215221, 37276925, 37684671, 38012622	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34071938	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30373552, 32513126	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21695196, 23074114, 24382740, 25243473, 25351113, 27506904, 34870494, 37542141	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22977660	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16014119	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10935492, 19047905, 28472813, 34548052	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	18310301	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	34784541	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	15375488		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	15639718, 20458558		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	11342781, 17561234, 18931615, 19898223, 22720981, 24715036, 26871282, 28984301, 30022838, 30592289		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	LHGDN	18459544		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	15639718, 20458558		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	28884749		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10720062, 10960636, 11489814, 12782587, 16176503, 16489075, 17535880, 18165403, 18690166, 19675076, 19749010, 20056644, 20959477, 21102415, 21695196, 22317867, 22351618, 23095717, 23390495, 23402742, 23580092, 24114859, 24171864, 24368280, 24376209, 24410765, 24466274, 24481591, 24604205, 24908329, 25243473, 26797759, 26871282, 27967255, 28073843, 28116735, 28264438, 28376175, 28467804, 28588698, 28859612, 28977954, 29137401, 29176513, 29196616, 29208958, 29807696, 29885789, 30302736, 30448218, 31077012, 31281524, 31495455, 31689915, 8541224, 9252329, 9605408, 9655254		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	15637090, 17173897		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	19200930, 20605134	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	28582344		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	37530323	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	37005704	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	16675850		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	11267940, 11342981, 26884359, 28108967, 28382636, 28498790, 28567703, 28901319, 29568948, 29848352, 29941485, 30170496, 30172938, 30423024, 30578311, 30789657, 30913871		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	14600184, 16484614, 16612467, 17309937, 17389465, 17446729, 17452407, 17510501, 17558892, 17702854, 17891599, 17971628, 19556726, 19926619, 20702456, 21658281, 22061094, 22324545, 25836047, 26535709, 28119050, 28292026, 28335423, 28736253, 28938457, 31100617, 31134999, 31173499		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	16484614, 16612467, 17702854, 19556726, 21658281, 22324545, 28938457, 35285386	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17513703		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	19926619		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	LHGDN	17951080		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	12082175, 14739915		★☆☆☆☆ Found in Text Mining only
Central Precocious Puberty	Central Precocious Puberty	BEFREE	23559367, 23585209, 29801469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	22669764, 26141719	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	28827713, 29275294, 31280197		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	30831289		★☆☆☆☆ Found in Text Mining only
Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	23112845, 26422690	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	24772998, 29420916		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	26531187		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	16179580, 17854418, 17971628, 18309176, 20699091, 22869326, 23763623, 27818250, 29420916, 30001721, 30729371, 31533892		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	22305517		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	27759449	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15361203, 19047174, 20581058, 24511005, 26056290, 28472813, 28924735, 29229929, 30173650, 30957588, 31452755		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	1651807, 28283546, 29532467		★☆☆☆☆ Found in Text Mining only
Cervical Migraine Syndrome	Migraine	CTD_human_DG	15133719		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15361203, 19047174, 20581058, 23923078, 24511005, 26056290, 28472813, 28924735, 29229929, 29532467, 30173650, 30957588, 31452755		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	20015871		★☆☆☆☆ Found in Text Mining only
Childhood Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19008315, 22439007, 22454254, 25885794, 28877739		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16936263, 22476540, 30284180, 32435051	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20172949, 22476540, 29890199, 30284180		★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	BEFREE	25066711		★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	Pubtator	25066711	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	22808109		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	22808109		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	23577061	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	25943116		★☆☆☆☆ Found in Text Mining only
Cholesterol gallstones	Cholesterol gallstones	BEFREE	23577061		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	30737997		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	11131982		★☆☆☆☆ Found in Text Mining only
Chorea Acanthocytosis Syndrome	Chorea	BEFREE	29253590		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11369444, 9303438, 9397958		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	23559367, 23585209		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	33299647	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	27220899	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	23773925		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	17327435, 17452407, 28396733, 28584624, 29423194, 29423210, 31583095		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23344476, 28339949		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21767241		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	21163127, 26688601, 29589156		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	24347629	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21837769, 28884481, 29085224		★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	11342781		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	17873121	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	17889406, 18288931, 22124532, 23932494, 28355325, 30222591, 33154391, 33522313, 36229517, 36697247, 38178204	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30544539		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	19886840	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	20505342, 21830274, 33299870, 34733451, 37960728	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31261736	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11212261, 16820927, 18225578, 21088384, 21161820, 22396198, 25683270, 29451783, 29605850, 31121307		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	20383761	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11212261, 19141699, 24080207		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36246978	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12359354, 14716825, 15742416, 16633920, 16788818, 20880178, 21425139, 21490239, 21699707, 21809392, 22729816, 24317156, 25970543, 27376509, 28578502, 28681123, 28794688, 29137421, 30013179, 30084990, 30645729, 31435166, 31590647, 9040793		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14716825, 19258481, 20383761, 20716622, 21699707, 23143558, 25970543, 31590647, 32334485, 35484177, 36183698, 37206439, 39547645	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16788818, 18706253, 18727987, 19142184		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19148895, 19258481, 27376509, 8640788		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27376509	Inhibit	★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	23548208, 28358936, 29141852, 29955142, 7496840		★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	25014269, 26485345, 26660680, 29082740		★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	17982251	Associate	★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	29438557		★☆☆☆☆ Found in Text Mining only
Congenital Disorder Of Glycosylation, Type In	Congenital disorder of glycosylation	BEFREE	28463089		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	25701261	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of breast	Breast hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23480168, 29932238		★☆☆☆☆ Found in Text Mining only
Constipation	Constipation	Pubtator	32416979, 36401732	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12207901, 12770739, 15867365, 19207611, 23460808, 25351113, 27107064, 30171816, 30271170		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12006396, 12691862, 14972425, 16014638, 16159931, 16179580, 16203927, 16207548, 16612068, 16612467, 18294052, 18360040, 18582450, 19008156, 19318036, 19608186, 20153472, 21106950, 21984528, 22284250, 23471591, 24171864, 24599688, 27706721, 28292026		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	20559769, 9396482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	11919305, 12006396, 12691862, 14972425, 16099331, 16159931, 16179580, 16207548, 16612068, 16612467, 17389465, 17558892, 18294052, 18360040, 18582450, 19008156, 19318036, 19446283, 19608186, 19938352, 20153472, 21106950, 21984528, 22284250, 23471591, 24171864, 24599688, 27706721, 30193537		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	11919305, 16612467, 24171864, 32682401, 34088265, 35197230, 35866398	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	16159931, 18294052		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	20559769, 9396482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	11919305, 33849106	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11919305, 12006396, 12691862, 14972425, 16159931, 16179580, 16207548, 16612068, 16612467, 18294052, 18360040, 18582450, 19008156, 19318036, 19608186, 20153472, 21106950, 21984528, 22284250, 23471591, 24171864, 24599688, 27706721, 30365458		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	11919305		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Thrombosis	Coronary Thrombosis	BEFREE	11894143		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	7885545		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30278183, 31043642, 31261736, 31435166, 31450614		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31261736	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	15899960, 17099213, 17283037, 18452179, 20887985, 22906643, 27376826		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	22580635, 22906643	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	16226111		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	16713399, 24223826, 28784925		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	16713399, 24223826	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	17184825		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10743824, 12847685, 15334463, 15380041, 15621207, 16098017, 16154319, 17391927, 20131243, 20417295, 21481553, 24089231, 24772413, 25325995, 25887457, 25892216, 31465913, 31711313		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	17391927		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	30981879		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	10362895, 10765041, 12174171, 15263903, 18072983, 20616674, 23491264, 23567436, 28789972, 28843780		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	18408366, 23491264, 36326669, 39596595	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	10765041, 19473078, 31319413		★☆☆☆☆ Found in Text Mining only
Depression Postpartum	Major depressive disorder	Pubtator	27108164	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	23917948		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21804148, 22051074, 22205149, 22901010, 26169989, 26620113, 28544903, 28716632, 28890035, 29263188, 29303703, 29447376, 29549264, 29636617, 29996916, 30500622, 31790664, 31823143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	22051074, 22094188, 22205149, 22901010, 24133901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	33289509	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	30017638		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	29318761		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	29318761, 29878374		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30053825		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	17077595, 20305341	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11894143, 18854778, 22810499, 25629224, 25679392, 26647383, 27396353, 27995352, 28736253, 29249638, 30487265, 30618092, 31293826, 31648126		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11894143, 18854778, 22810499, 25629224, 25679392, 26647383, 27396353, 27995352, 28736253, 29249638, 30275758, 30487265, 30618092, 30723056, 31293826, 31600634, 31648126		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20210241, 25854171, 29249638, 30275758, 33338031, 36788175	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24523574, 28634856, 30942443, 35650387	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15774022, 18305958, 19556726, 23506158, 25077953, 33748055	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28712835	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	21943781, 24029427, 24523574, 26077347, 28634856, 29667912, 30096284		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11275948, 17097034, 17327435, 17513703, 18305958, 18854778, 19556726, 21837403, 23506158, 25077953, 27053251, 27396353, 28185712, 28645613, 29141994, 29339527, 29378845, 29883973, 30201537, 30487265, 30679303, 31293826, 31395589		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	28634856	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	18305958, 24523574, 40214234	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	18305958		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	40214234	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	36401732	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27357538		★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	32553473	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	23497414	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	18408366		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	18408366		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	18408366	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	18619437		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	36982683	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	15217512, 15692763, 16021574, 18720524, 27891654, 28422875, 29904427, 30237211, 31451564, 8744803		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	10338072, 15328190, 15619212, 16021574, 19762336, 20658316, 20813035, 21284437, 22237979, 27153444, 28118820, 29904427, 30237211, 31451564, 9137083		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	31816282		★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	28161223		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	22383464	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	19060449, 22011627, 31661889		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35227068	Associate	★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	29198300		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	24282178		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	30630878		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	21564416, 21983130, 24715036, 26252518, 26431491, 30057548, 30584245		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	30270031	Stimulate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	16827106, 16869955, 18974135, 20889718, 21713035, 22669764, 23033157, 23401605, 24185510, 24449872, 24467828, 24496634, 27224909, 27539025, 28306507, 28507152, 28679775, 28985022, 29063679, 29192207, 29614078, 29974997, 30158597, 30302736, 30573703, 30944316, 31426673, 31839155, 32684154, 33086721, 33098638, 33407744, 33466512, 34097174, 34101078, 34779498, 34961764, 35628441, 35653148, 35920686, 36332363, 36436079, 36493359, 36518248, 37226020, 37524698, 38017133, 38072514, 38160230, 39207954, 39512757, 40598566	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	18087590	Stimulate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	21860415, 26801869, 32502940, 35121623, 36048167	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	11812086, 12488337, 15094777, 16681769, 17717078, 20596625, 24557437, 28454369, 30851587, 9449246		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10101596, 10385549, 10415108, 10612426, 10753195, 11051252, 11109162, 11207052, 11496303, 11603221, 11698343, 11751515, 11861507, 12017277, 12055672, 12065875, 12088871, 12115520, 12138194, 12170086, 12270131, 12553024, 12943742, 12962933, 12970323, 14601091, 14645498, 14762440, 15010819, 15149734, 15528307, 15581976, 16093440, 16303170, 16567092, 16596174, 16690106, 16739346, 16809439, 16825317, 17010074, 17170081, 17240435, 17434921, 17466050, 18043286, 18292933, 18720455, 18788074, 18798221, 18807138, 18852162, 18937711, 18990228, 19088370, 19160418, 19319135, 19371625, 19383985, 1939212, 19432902, 19438492, 19759112, 20012305, 20126312, 20381444, 20529558, 20596625, 20620597, 21048224, 21102415, 21139866, 21272446, 21363919, 21802511, 21878365, 22025313, 22075757, 22139444, 22325788, 22404101, 22415229, 22876322, 23051957, 23306391, 23319822, 23593326, 23688837, 23754174, 23873111, 24023309, 24039841, 24185510, 24366110, 24498137, 24853175, 25182852, 25592200, 25766326, 25884434, 26330482, 26395027, 26428028, 26957478, 27018308, 27033325, 27197147, 27342949, 27527851, 27696906, 27870712, 27888807, 27974701, 28052940, 28382516, 28454369, 28476021, 28540420, 28578502, 28582344, 28664899, 28978098, 28984301, 29081408, 29085506, 29207611, 29250656, 29300901, 29331043, 29406446, 29539426, 29636868, 29665555, 29799481, 30057548, 30127640, 30277666, 30420335, 30569100, 30586414, 30616900, 30706380, 30779215, 31119046, 31140648, 31220580, 31322541, 31330844, 31362937, 31395281, 31576449, 31686835, 31778358, 31796030, 7542977, 7784019, 7995615, 8344199, 8910626, 8918973, 9103405, 9113991, 9259322, 9393947, 9738013		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	24185510		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Diseases	Endometrial Diseases	BEFREE	10620447		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	11820567, 17561234, 18720455, 19759112, 21564416, 25809780, 29250656, 30745857		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	LHGDN	14559803		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	14601091, 15882182, 22102068, 25495249, 30745857	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	27516013	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10816575, 11006576, 11207052, 15579769, 15800680, 15882182, 16681769, 16884380, 17352221, 17466050, 18990228, 19319135, 19383985, 19420986, 19432902, 19758455, 19759112, 19775474, 19820388, 20126312, 20593959, 21048224, 21079811, 21720253, 21734474, 21790217, 22025313, 22170435, 22249577, 22415229, 23051957, 23055021, 23318908, 23409030, 2344964, 23530112, 23706170, 23719407, 24039841, 24185510, 24495253, 24947674, 25154549, 25182852, 25766326, 25884434, 26218748, 26299454, 26308378, 26330482, 26824324, 26859414, 26930451, 26957478, 27342949, 27516013, 28052940, 28167798, 28476021, 28498246, 29081408, 29264761, 29324536, 29539426, 29799481, 30277666, 30614867, 31362937, 31778358, 31865530, 31909459, 31990345, 32210157, 32413043, 32503542, 32639950, 32894083, 33835469, 34019887, 34414815, 34953233, 35018885, 35365770, 35830453, 36348508, 36396974, 36513790, 36769338, 36788084, 37257767, 37363949, 37797425, 37904149, 37924026, 38358190, 39515079, 40235068, 40243611, 7542977, 7856758, 7891714	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12088871, 12873984, 12962933, 14559803, 14691461, 14762440, 15581976, 15800680, 18720455		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23873111, 26542589	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	24185510		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	28052940, 9685214		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	18580489, 28114189		★☆☆☆☆ Found in Text Mining only
Endometrioid carcinoma ovary	Ovarian endometrioid carcinoma	BEFREE	28264438, 29178260		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	10381820, 10421802, 10856486, 11020519, 11384649, 26239024, 30728052		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10428168, 11139535, 12650711, 14683420, 15193490, 15589880, 15749482, 16169423, 16210018, 16388018, 16500359, 17121748, 17343855, 18178192, 18687423, 19001520, 19729795, 19878085, 20586553, 20826587, 20857063, 21110202, 21269613, 21958689, 22222969, 22271293, 22884659, 22890138, 23177411, 23755949, 24427778, 25051436, 26394174, 26453052, 26653759, 26704524, 26976855, 27373811, 27939762, 28537267, 28578502, 28927243, 29299139, 29383962, 29629944, 29998468, 30063121, 30078406, 30203794, 30302736, 30356372, 30684560, 30753135, 30965114, 31504401, 31629931, 7805924, 9701786		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	10428168, 15589880, 15749482, 16169423, 16500359, 18048499, 18178192, 18687423, 19001520, 19729795, 19878085, 20586553, 21269613, 22520060, 23899551, 24427778, 25217304, 26134036, 26976855, 29383962, 29664547, 30302736, 32416979, 33394050, 33817715, 34794738, 35285386, 35303800, 35401535, 36672827, 36860677, 37624743, 40243611	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	LHGDN	15749482, 16169423, 16210018, 16500359, 16855153, 17121748, 17413977, 17454161, 17548071, 18048499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	16210018, 17454161, 22977660, 23749764, 37828053, 7805924	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	17548071, 22884659	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	GWASCAT_DG	28537267		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enlarged polycystic ovaries	Enlarged polycystic ovaries	HPO_DG			★☆☆☆☆ Found in Text Mining only
Enthesitis	Enthesitis	BEFREE	31121314		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	29948734, 30476270		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	30578870		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	30578870	Associate	★☆☆☆☆ Found in Text Mining only
Epidermal Nevus	Epidermal nevus	Pubtator	35701387	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	12810536, 31608530		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	21390307, 28334947	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	19490052		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16489075, 20056644, 21695196, 24114859, 24376209, 24481591, 27967255, 28116735, 28467804, 28588698, 28977954, 29137401, 29176513, 29208958, 29807696, 31281524		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	10720062, 9850067		★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	11194191		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	8491760		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31888440	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22463081, 27595756, 35645543	Associate	★☆☆☆☆ Found in Text Mining only
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	20705611, 22114931, 23402742, 23841731, 24485503, 27754803, 30113650, 7664983, 8541224		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN RESISTANCE	Estrogen Resistance	UNIPROT_DG	23841731, 27754803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN RESISTANCE	Estrogen Resistance	ORPHANET_DG	23841731, 8090165		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN RESISTANCE	Estrogen Resistance	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN RESISTANCE	Estrogen Resistance	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Estrogen resistance syndrome	Estrogen Resistance	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	10713392		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Familial Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	30165855		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	11016622, 11342781, 30450159		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28220039, 29615085, 31168625		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	29615085, 31062612	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28760353		★☆☆☆☆ Found in Text Mining only
Female Urogenital Diseases	Female Urogenital Diseases	CTD_human_DG	16002989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrillary Astrocytoma	Fibrillary Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	LHGDN	15763593		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	16554735, 19367380, 27056456		★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	20846920, 27713419, 29362861	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	10574596, 11035987, 11232041, 11297607, 11826769, 12065682, 12149410, 12524070, 15474102, 15547533, 16603566, 16935316, 17121748, 18166184, 18701604, 19012097, 19240151, 19729795, 21421902, 22377971, 24384850, 26529545, 27100507, 27454940, 28203428, 30390345, 30431607, 31468104, 7775635, 9253340, 9780024		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	11826769, 15474102, 17121748, 17646097, 17992477, 18492705, 19012097		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	CTD_human_DG	18701604		★☆☆☆☆ Found in Text Mining only
Fibromatosis	Fibromatosis	BEFREE	27259010		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	18414401		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29704446		★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Hereditary folate malabsorption	Pubtator	28445960	Inhibit	★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	28445960		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22808109, 25066711		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	22808109, 24009453, 25066711, 25632198, 37787296	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	31782270	Stimulate	★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	22808109	Stimulate	★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	22808109	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	32883271	Associate	★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	14555521		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	10609065, 11407083, 16859590, 28843802, 29303708		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	29318761, 29878374		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	9492061		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	10776938		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	18195227		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	18195227		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31322012		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11604247, 25695958, 26898538, 30417588		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30417588, 32240464, 32825553	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26898538, 30417588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	15604281, 19822186, 22442308, 23399685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	32240464	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gliosarcoma	Gliosarcoma	Pubtator	17316362	Inhibit	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	23973528		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	20962747		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Grade I Astrocytoma	Grade I Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	12815477		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	10720062, 25167139, 29653259		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	LHGDN	17885486		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	11887032, 21423915, 9745443		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	29718547		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	21597315, 24625355, 29772574		★☆☆☆☆ Found in Text Mining only
Hamman-Rich Disease	Diffuse interstitial pulmonary fibrosis	CTD_human_DG	30165855		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28544903, 9745443		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32664164	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29932238		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	30340617	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	8640788		★☆☆☆☆ Found in Text Mining only
Hemicrania migraine	Hemicrania Migraine	CTD_human_DG	15133719		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	15215164	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	28990845		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	29082740		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	29082740	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	32663496	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	18204202, 26510790, 31476594	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	19305383, 20569503, 21800290, 22252842, 22524806, 23709174, 24337596, 24495356, 24951027, 25421376, 27217450, 30796653, 40227228	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	9713824	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	29085224	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10102472		★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	10903615, 16859517, 17852416, 23474223, 27964748, 32047236, 34866317, 35959983, 39694404	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11400682, 12960427, 14710227, 15084249, 16280033, 16760287, 17553133, 20383761, 20716622, 20739354, 21281495, 21596782, 22576469, 22622808, 23288344, 25027393, 26494790, 26887643, 27498697, 27525837, 27821721, 28225892, 30190545, 30286806, 30394935, 30614867, 30705367, 31110002, 31959131, 32393308, 32860329, 34831091, 36124682, 37009655, 37390283	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	9113991	Associate	★☆☆☆☆ Found in Text Mining only
hereditary paraganglioma	Hereditary Paraganglioma	BEFREE	24465590		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	27034161		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	8530610		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	36385124	Associate	★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	29082740		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	Pubtator	29082740	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	19138995, 9790998		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	24721462, 26350565, 29130512		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	12006396		★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	25077953		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25448744, 26647383, 29331414		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	8090165	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	19927160, 29029469		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	35866398	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	24225450	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	12006396		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Primary	Hyperparathyroidism	Pubtator	37651007	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	9426425		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	15882182	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	25122196	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19218192, 25077953, 32664164	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11894143, 17095210, 17971628, 19284296, 21734414, 23128795, 25765937, 28157814, 28189710, 28340239, 28560446, 30635990, 31028794, 31752065, 8458645		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17971628		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	32838791	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	LHGDN	18617186		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	19584059, 34944396	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	16492615	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy of parotid gland	Hypertrophy Of Parotid Gland	BEFREE	31199565		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	39796505	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	36828304, 37049500	Associate	★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	BEFREE	27879963, 29339527, 31696669		★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism - autosomal dominant	Hypoparathyroidism	BEFREE	23435732		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	16553027, 18375409, 19864317, 20215396, 23088992, 25463985, 31520742		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	LHGDN	17453687, 18375409		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	22341273, 22580635, 23088992	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11676860, 28320353, 31163125	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17140257, 19952428, 20569445, 23159849, 23685731, 23696831, 25007177, 25823469, 26372732, 26598706, 27105516, 34792178, 38517892	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21707866	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	27879963		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	20081107, 25765937, 27402919, 28775043, 29886191, 30980910, 31509349		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	30165855		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31291549		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune System Diseases	BEFREE	10776938		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	36788175, 37005704	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	11955468, 16538187, 16699281, 17889406, 18072983, 18342444, 20616674, 23567436, 23932494, 24150894, 28355325, 28956815, 30096284, 30201537, 30544539, 30690641, 31430865, 31608530		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	28744158, 30340617		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	18835831, 19866355, 20586553, 21269226, 22749220, 24427778, 37396743	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	23913373, 34398012	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15699342, 17093903, 30251059, 31678865		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	11212228, 16951220, 17700572, 18211679, 21092257, 24574065, 24634376, 27448983, 27663569, 28426875, 30275857, 30338425, 30915662, 30933323, 31006821, 31120565, 31357602		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	28816991		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22296324, 24512691, 25077953, 28472101, 30275758	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33660790, 40510349	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	33101543	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30831289		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	36466848	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Astrocytoma	Intracranial Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	28303349		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	BEFREE	27628953		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	35643225	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	10022453, 11342981, 15574760, 17019712, 21913743, 24456584, 24522996, 25357113, 25845386, 27928699, 27993580, 28333404, 28373460, 28567703, 28765906, 28901319, 29135722, 29941485, 30110018, 30170496, 30172938, 30456680, 30578311, 30962690, 31119054, 31281731, 9012459		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	24966932, 28774781		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	16983080		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17493601, 17971628, 18309176, 20153472, 22760258, 26422690, 26784014		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	19565513, 26305060, 28241879, 30762291, 31655933, 31707543		★☆☆☆☆ Found in Text Mining only
Juvenile hemochromatosis	Hemochromatosis	BEFREE	25281718		★☆☆☆☆ Found in Text Mining only
Juvenile Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	14739915		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	16820371, 17327435, 18305958, 24029427, 24523574, 26908832, 29237779, 31598700		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18305958	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18305958	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	17327435, 17452407, 28396733, 28584624, 29423194, 29423210, 31583095		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	17327435, 18305958		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	11555647	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28889782, 31539535		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	10574596, 29258902, 30431607, 9891238		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	17095210, 28860666		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	LHGDN	17095210		★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Leigh syndrome	Pubtator	25692143	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	10487678, 12524070, 15066464, 18166184, 18492705, 18853184, 19012097, 19639498, 19729795, 21506659, 25625804, 27100507, 28600036, 29020039, 31804368, 3232551, 33252597, 36890612	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyoma	Leiomyoma	Pubtator	32046421	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leiomyosarcoma	Leiomyosarcoma	BEFREE	10574596, 29318761, 30431607, 9891238		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	15066464, 19626649, 21161468, 29318761, 33788262	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	29258902	Inhibit	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	31494310		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	CTD_human_DG	18808365		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	20383761, 21683083, 24990611, 29364483, 29445159	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	2046384, 25307539, 26721669, 29364483, 29445159, 8640788, 9130685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11313277, 18692045, 22333393	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10353741, 11313277, 29789325		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	18569637		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	25876993		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	22878818		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	10574596, 29258902, 30431607, 9891238		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28374517, 28734725, 29770127		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	22011627		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	22011627		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	25836047	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10330684, 10854714, 10915729, 12161003, 12403846, 12879470, 15026472, 15116322, 16633737, 16762623, 19064581, 20383761, 20458558, 21348637, 21610700, 23042559, 23054207, 23109139, 23695389, 24126791, 24481452, 24975878, 25014269, 25270093, 25483016, 26503703, 26660680, 26804600, 27899088, 28192186, 28302149, 28334234, 29085224, 29134746, 29358876, 29563759, 30349537, 30510575, 30641053, 30940293, 31168625, 31400761, 7834616, 8750171, 9537437, 9931090		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16757575, 16762623, 19027010		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19363144, 28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21837769, 23109139, 25014269, 28884481, 29085224		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	26608979	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	31867004	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	12879470, 22727021	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	29082740		★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	22727021	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	22727021		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10330684, 24481452, 26542749, 27757837, 8750171, 9931090		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	16712894		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lumbar disc disease	Lumbar Disc Disease	BEFREE	12429765		★☆☆☆☆ Found in Text Mining only
Lumbar scoliosis	Lumbar scoliosis	BEFREE	27399961		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31291549, 31506089		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	35017776	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11035577, 16214508, 16334162, 19995644, 22132110, 22693540, 22918549, 23608817, 26301798, 27267852, 36035842, 38021219	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	11872642, 11929836, 15986439, 21062926, 26678909, 29233790, 30444717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	11872642, 17077188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	18949413		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	11168443, 11407298, 24861435, 27290913, 27989899, 28822833, 30416032, 9676761		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19399944, 29643853, 31412880	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21463834	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	11168443, 11407298, 24861435, 27290913, 27989899, 28822833, 30416032, 9676761		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10779406, 11168443, 11407298, 11764210, 15361380, 15817658, 15934440, 19399944, 20305046, 20961965, 21463834, 24449583, 24861435, 25286391, 26546109, 27290913, 27590999, 27681518, 27989899, 28039554, 28707126, 28820360, 28822833, 29356461, 29422675, 29550813, 29643853, 30416032, 30572014, 31345653, 8905552, 9676761		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15934440		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	11818702, 27989899, 28385126		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	11168443, 11407298, 24861435, 27290913, 27989899, 28822833, 30416032, 9676761		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	18285421, 26026095, 31260937		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10433957, 12679906, 15084241, 18499701, 20514458, 21625942, 22502679, 25010932, 25027393, 25113249, 25576212, 26191291, 27756653, 28765906, 29745079, 30587150, 30705367, 30722113, 33464691, 33858677, 34319022, 37476497, 38358190	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	15890247, 28983626		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20390465, 29390981	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21188569, 24289629, 30479097	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15916684, 18636124, 26721669, 8640788		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15916684, 18636124	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	18636124		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18636124, 30736096, 32196124	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	18636124, 30736096		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	7522544		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	26554525, 29760622		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	12605096, 15576061, 17365134, 22051074, 22901010, 26169989, 28589742		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	LHGDN	15576061		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	14528100, 17266178		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	21430602, 31657853		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15639718, 17659810		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	26729015		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	16216906, 23074235, 26312764		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10022453, 10022773, 10030690, 10066069, 10096242, 10101196, 10330684, 10338072, 10357772, 10359819, 10379895, 10385549, 10389938, 10402236, 10419456, 10446899, 10459848, 10471050, 10477167, 10504548, 10517346, 10519397, 10521493, 10542244, 10554009, 10554010, 10579349, 10595257, 10601561, 10612431, 10619354, 10630402, 10634517, 10639512, 10680597, 10690532, 10719737, 10754501, 10763153, 10766163, 10766344, 10800077, 10810301, 10815765, 10819506, 10819507, 10822014, 10825128, 10831156, 10835497, 10850416, 10866661, 10868478, 10874041, 10890895, 10914724, 10940647, 10955825, 10967555, 10969774, 10999774, 11004670, 11012095, 11014213, 11029767, 11050174, 11051252, 11056692, 11059753, 11072241, 11072781, 11084868, 11103799, 11110848, 11133808, 11134191, 11136970, 11156322, 11156387, 11159857, 11165756, 11169738, 11186170, 11226828, 11237771, 11238942, 11244506, 11245479, 11289701, 11309328, 11311599, 11320145, 11376135, 11384768, 11400122, 11410514, 11429696, 11448539, 11459795, 11494058, 11502892, 11507038, 11517301, 11519865, 11555606, 11562176, 11676860, 11705859, 11711119, 11731427, 11738552, 11738556, 11751417, 11768608, 11779841, 11781824, 11782368, 11782371, 11821247, 11830647, 11859876, 11866593, 11867202, 11867264, 11879565, 11888893, 11897503, 11911440, 11911945, 11931841, 11952337, 11968000, 11968011, 11981002, 12004807, 12013534, 12014631, 12037682, 12088871, 12100115, 12112006, 12114443, 12125913, 12140767, 12154049, 12174911, 12183401, 12208729, 12208749, 12370825, 12408373, 12432273, 12438565, 12451035, 12459712, 12462383, 12527894, 12527905, 12529347, 12554767, 12560434, 12569569, 12586845, 12589938, 12611455, 12615709, 12616383, 12631589, 12654308, 12657462, 12705869, 12710998, 12726856, 12727813, 12730327, 12736560, 12736563, 12738788, 12746304, 12750288, 12789259, 12790782, 12790785, 12790787, 12810680, 12817998, 12839940, 12874002, 12889606, 12902984, 12908818, 12929585, 12943695, 12943740, 1295449, 12960427, 12970748, 1345763, 1356959, 1362141, 1421423, 1423300, 14504194, 14507640, 14517345, 14519755, 14522892, 14559831, 14566818, 14570715, 14572667, 14576841, 14580261, 14614325, 14637391, 14638681, 14645421, 14661035, 14676837, 14680484, 14682440, 14702633, 14708971, 14713265, 14715875, 14718389, 14729609, 14729654, 1495491, 14973112, 14981916, 1498488, 14985456, 14996713, 15001399, 15008248, 15012604, 15012607, 15016320, 15026085, 15041722, 15044858, 15059906, 15060629, 15073102, 15084237, 15084241, 15087408, 15111762, 15126109, 15135471, 15149721, 15149724, 15171723, 15171727, 1517234, 15175332, 15182430, 15183535, 15217512, 15217513, 15254667, 15254972, 15283693, 15311216, 15328190, 15372466, 15374949, 1537883, 15383631, 15449313, 15459489, 15481440, 15528301, 15544494, 15548683, 1556769, 15578079, 15581976, 15585645, 15591335, 15604249, 15604281, 15623590, 15637147, 15662126, 15692750, 15695404, 15701881, 15703542, 15709176, 15723605, 15731693, 15735025, 15746191, 15762987, 15772083, 15788639, 15790432, 15796211, 15816560, 15821115, 15821116, 15824731, 15824740, 15831516, 15856463, 15862947, 15862952, 15867365, 15867376, 1587835, 15886208, 15923424, 15930283, 15930334, 15930460, 15945099, 15947004, 15958618, 15986123, 15989967, 15999154, 16012712, 1603086, 16033833, 16054421, 16084894, 16091743, 16093440, 16099479, 16103452, 16119004, 16140974, 16150902, 16152589, 16166291, 16168139, 16172792, 16215870, 16245302, 16261164, 16267616, 16280033, 16284392, 16288120, 16297086, 16314399, 16319983, 16328721, 16331276, 16391838, 16401708, 16408291, 16417653, 16424042, 16446345, 16455026, 16475675, 16475975, 16489054, 16491124, 16492926, 16502042, 16505416, 16514628, 16541309, 16546983, 16551498, 16551856, 16551874, 16569260, 16585219, 16608533, 16609009, 16609042, 16615154, 16617102, 16635015, 16636675, 1664044, 16679312, 16707596, 16723304, 16723714, 16728566, 16737553, 16740736, 16740749, 16754886, 16754938, 16760653, 16788379, 16791593, 16808847, 16809439, 16809442, 16826462, 16827106, 16849564, 16849584, 16885352, 16886637, 16893382, 16893667, 16919882, 16941532, 16945990, 16951146, 16954440, 16969100, 16980581, 16998594, 17001676, 17010071, 17010072, 17013392, 17014703, 17016654, 17018635, 17068199, 17076897, 17083744, 17088071, 17089000, 17092701, 17095596, 17108141, 17127330, 17140257, 17145895, 17158757, 17158758, 17158759, 17170218, 17186358, 17187234, 17187513, 17206280, 1722871, 17268813, 17275315, 17280502, 1728420, 17297453, 17312270, 17317819, 17329190, 17332335, 1735610, 17360330, 17363578, 17395975, 17401012, 17404087, 17407600, 17417639, 17428314, 17434921, 17447208, 17452776, 17453340, 17456797, 17473282, 17475478, 17477366, 17510434, 17545528, 17545614, 17553133, 17562079, 1756270, 17573968, 17574840, 17578664, 17587186, 17591841, 17594514, 17598908, 17599055, 17617929, 17621625, 17631997, 17634531, 1763658, 17646931, 17660348, 17663798, 17671699, 17683518, 17685448, 17687644, 17690249, 17699777, 17700572, 17710163, 17761946, 17785450, 1779964, 1779972, 17850661, 17875680, 17880733, 17889406, 17894856, 17899364, 17904846, 17908967, 17911387, 17914099, 17926035, 17932744, 17951401, 17957784, 17960616, 17973251, 17975003, 17975144, 17992394, 17993718, 18000217, 18000219, 18006786, 18006915, 18020983, 18022314, 18030330, 18037997, 18045953, 18048329, 18056179, 18056180, 18059161, 18072233, 18076012, 18078353, 18086271, 18091988, 18172323, 18183590, 18211679, 18223215, 18224398, 18226260, 18231641, 18240019, 18240998, 18243688, 18254957, 18256928, 18268121, 18269587, 18271972, 18281517, 18288417, 18288420, 18301357, 18307012, 18310281, 18316615, 18337089, 18342836, 18347175, 18360352, 18365014, 18374156, 18377699, 18381935, 18386815, 18405391, 18409071, 18417735, 18420392, 18424034, 18425577, 18438407, 18439640, 18443585, 18446835, 18451146, 18451179, 18457947, 18473934, 18483177, 18485221, 18497058, 18497066, 18498629, 18498876, 18499701, 18501937, 18508997, 18518979, 18519782, 18521745, 18550772, 18563553, 18565642, 18574464, 18587642, 18592372, 18593897, 18593943, 18628976, 18629629, 18631401, 18637494, 18644889, 18645020, 18657139, 18668363, 18678474, 18690166, 18705646, 18710328, 18712725, 18714337, 18714348, 18752184, 18755890, 18768663, 18784357, 18784433, 18787018, 18788074, 18790736, 18820009, 18837889, 18838536, 18843012, 18845558, 18928543, 18946747, 18958632, 18979234, 18981002, 18984771, 18991569, 19011961, 19013891, 19020750, 19021634, 19025599, 19028704, 19028706, 19035303, 19082494, 19082709, 19082882, 19084502, 19088016, 19094228, 19095746, 19112174, 19116762, 19126777, 19130408, 19144873, 19148464, 19154418, 19156836, 19159686, 19167446, 19167496, 19179608, 19217708, 19219042, 19223511, 19224856, 19225135, 19237581, 19246968, 19250197, 19250200, 19261198, 19264808, 19270750, 19272155, 19274700, 19287456, 19289846, 19292896, 19298602, 19305383, 19320640, 19321582, 19323294, 19339517, 19342371, 19351835, 19351845, 19364822, 19366795, 19367284, 19370415, 19372580, 19381686, 19383343, 19384950, 19390427, 19398483, 19411863, 19414322, 19414598, 19429437, 19433448, 19435816, 19435893, 19451819, 19487288, 19487384, 19491898, 19496786, 19505923, 19507020, 19509295, 19522736, 19526339, 19549254, 19567422, 19567831, 19575750, 19578798, 19584287, 19587092, 19605405, 19609101, 19609668, 19628648, 19630952, 19638585, 19651820, 19657672, 19661335, 19671761, 19698761, 19707857, 19718048, 19723326, 19724876, 19729795, 19738052, 19738412, 19739079, 19744330, 19760036, 19762336, 19771505, 19772891, 19800002, 19806012, 19836388, 19838210, 19842031, 19843668, 19847644, 1985035, 19851860, 19856316, 19861523, 19874578, 19875957, 19879889, 19879930, 1988075, 19895368, 19898421, 19898422, 19901195, 19903847, 19905902, 19920189, 19928762, 19935720, 19940156, 19941161, 19943940, 19946260, 19946334, 19956951, 19996302, 20020198, 20023245, 20025868, 20027631, 20042638, 20045728, 20061804, 20068169, 20076999, 20079471, 20087860, 20101208, 20101445, 20104523, 20104649, 20116857, 20140701, 20145118, 20146796, 20149218, 20151319, 20156214, 20156333, 20156340, 20170107, 20179226, 20179234, 20179241, 20181721, 20186046, 20197399, 20205715, 20213080, 20215533, 20221692, 20224929, 20231686, 20234815, 20237034, 20300827, 20301197, 20308691, 20346095, 2035527, 20370918, 20379846, 20382698, 20386540, 20388878, 20403033, 20404251, 20410173, 20425602, 20429621, 20431938, 20437200, 20457620, 20458558, 20459607, 20460512, 20460518, 20467919, 20479250, 20482834, 20484043, 20484105, 20487521, 20490325, 20490651, 20496165, 20501593, 20528735, 20530877, 20531297, 20531310, 20531416, 20547751, 2054780, 20549348, 20550710, 20551055, 20556506, 20564629, 20569503, 20570586, 20570923, 20577047, 20579400, 20592103, 20596943, 20603605, 20604969, 20605569, 20607599, 20608937, 20625127, 20661439, 20664043, 20665103, 20682797, 20683691, 20689759, 20691160, 20696638, 20696891, 20697068, 20699374, 20705611, 20711236, 20711807, 20713855, 20724461, 20724828, 20729066, 20730598, 20734429, 20735436, 20739888, 20798217, 20804917, 20805453, 20807815, 20809360, 20817789, 20846920, 20852631, 20858276, 20878674, 20883782, 20889557, 20889718, 20920219, 20929399, 20932292, 20934245, 20935677, 20937382, 20945086, 20946668, 20960227, 20966540, 20975711, 20978187, 20978202, 20980149, 21036734, 21059212, 21059815, 21064098, 21069738, 21078168, 21080930, 21084382, 21105050, 21108837, 21111561, 21118977, 21120602, 21122099, 21127199, 21129193, 21151129, 21152022, 21160418, 21167036, 21167057, 21169420, 21184269, 21184271, 21191116, 21203899, 21217774, 21223569, 21226615, 21248301, 21263130, 21266059, 21266162, 21266827, 21267694, 21272446, 21276249, 21281495, 21282336, 21289296, 21292820, 21292829, 21299862, 2131044, 21325141, 21326033, 21331623, 21336547, 21338212, 21342038, 21356271, 21358301, 21362200, 21364760, 21367843, 21369698, 21369717, 21378333, 21389782, 21392396, 21410323, 21410584, 21420993, 21425139, 21431343, 21435239, 21442356, 21445275, 21447808, 21454576, 21459801, 21470560, 21477609, 21480222, 21482760, 21492444, 21499302, 21509526, 21516302, 21523713, 21524465, 21541704, 21546925, 21552322, 21554733, 21575280, 21593217, 21595884, 21598989, 21602804, 21607583, 21607585, 21617856, 21625942, 21642474, 21643930, 21655924, 21658239, 21664418, 21666713, 21677473, 21684697, 21687957, 21690342, 21695171, 21705183, 21706157, 21707964, 21713035, 21717460, 21720988, 21734015, 21737465, 21741601, 21748818, 21750172, 21750966, 21755340, 21761348, 21761362, 21765473, 21771784, 21814749, 21818254, 21821674, 21825015, 21826373, 21826535, 21840388, 21852249, 21858728, 21860415, 21862633, 21863258, 21868547, 21875255, 21880792, 21887697, 21893353, 21896991, 21900106, 21908557, 21909982, 21920899, 21924251, 21925980, 21939527, 21944253, 21946067, 2194831, 21951600, 21984977, 21986093, 21988594, 21993004, 21996731, 22012767, 22016394, 22026417, 22034498, 22035181, 22042793, 22049316, 22053771, 22056872, 22064478, 2206558, 2207345, 22074947, 22083956, 22087758, 22094188, 22096658, 22105146, 22112941, 22112967, 22113133, 22114931, 22119744, 22123186, 22124578, 22125492, 22144499, 22151997, 22156833, 22157294, 22158035, 22158050, 22158945, 22170254, 22174013, 22182837, 22199302, 22207555, 22209867, 22212555, 22217937, 22228098, 22231421, 22231442, 22234518, 22245973, 22261811, 22262870, 22263793, 22264274, 22266866, 22267197, 22267707, 22270937, 22274868, 22274890, 22286763, 22291085, 22291441, 22291950, 22293394, 22301704, 22301780, 22307688, 22322671, 22323552, 22331459, 2233741, 22342541, 22345291, 22348646, 22351618, 22362381, 22367215, 22374518, 22374725, 22391567, 22399296, 22402113, 22402307, 22404099, 22418568, 22429463, 22442272, 22446103, 22452962, 22460789, 22464689, 22476901, 22476979, 22480149, 22502712, 22510516, 22511931, 22515611, 22521644, 22530051, 22543272, 22550166, 22551578, 22553917, 22558281, 22559974, 22576469, 22576740, 22581656, 22584640, 22591913, 22594760, 22596188, 22606272, 22613997, 22616702, 22617030, 22622808, 22623953, 22626971, 22638694, 22644656, 22644675, 22662208, 22669764, 22673335, 22692575, 22699783, 22703232, 22710975, 22711074, 22719059, 22723919, 22733972, 22738294, 22745190, 22747683, 22751110, 22752292, 22765268, 22771536, 22787161, 22788972, 22791811, 22792352, 22799738, 22799881, 22807578, 2280770, 22810499, 22812573, 22819674, 22820289, 22824300, 22825374, 22844580, 22848668, 22850893, 22855140, 22875023, 22875649, 22878818, 22892847, 22907427, 22922440, 22929540, 22930220, 22947396, 2295073, 22964581, 22965832, 22967435, 22971638, 22973058, 22975348, 22976474, 22986521, 22992372, 23000059, 23001124, 23001908, 23012411, 2302226, 23022997, 23023562, 23035882, 23045591, 23049873, 23053664, 23053665, 23054611, 23056300, 23063783, 23064179, 23065001, 23065768, 23068099, 23071542, 23079576, 23098526, 23104890, 23109706, 23115015, 23117886, 23124476, 23136140, 23136197, 23142364, 23142699, 23151593, 23159947, 23169272, 23173005, 23178495, 23178685, 23183268, 23184080, 23184698, 23192763, 23203101, 23216744, 23228987, 23244119, 23244312, 23248117, 23250869, 23251644, 23253910, 23267128, 23268322, 23272245, 23274857, 23284898, 23285017, 23291854, 23300383, 23319441, 23342282, 23344024, 23346221, 23347430, 23348384, 23374155, 23379261, 23390529, 23391338, 23391903, 23402757, 23403054, 23403292, 23404426, 23435732, 23442322, 23443115, 23443804, 23448346, 23460808, 23467929, 23468243, 23486015, 23486537, 23499324, 23503643, 23504136, 23506684, 23512947, 23516639, 23518928, 23525242, 23526455, 23530639, 23533663, 23535344, 23535731, 23535733, 23535825, 23536962, 23542418, 23547709, 23559098, 23563506, 23568005, 23576735, 23588792, 23592700, 23593223, 23593342, 23598999, 23602897, 23609471, 23618950, 23624936, 23635953, 23644255, 23650283, 23657153, 23658396, 23663520, 23664836, 23666105, 23676274, 23679233, 23682072, 23686317, 23686416, 23690508, 23715497, 23723333, 23741969, 23744764, 23750285, 23754601, 23757354, 23758962, 23762395, 23764000, 23764426, 23770244, 23782942, 23786776, 23800221, 23810005, 23810988, 23813010, 23816933, 23817433, 23818839, 23828443, 23832257, 23832664, 23832666, 23839043, 23840656, 23842740, 23847351, 23857602, 23861345, 23861811, 23868472, 23871935, 23874830, 23875016, 23885756, 23891847, 23893181, 23894323, 23900261, 23900300, 23909066, 23912957, 23913582, 23914993, 23918832, 23918944, 23923010, 23928990, 23935944, 23939688, 23945331, 23947965, 23948299, 23951298, 23971947, 23973262, 23973528, 23977306, 23979844, 23986557, 23988612, 23991038, 23991131, 23991950, 23996684, 24004841, 2400987, 24011769, 24019118, 24027428, 24031087, 24043118, 24047697, 24052622, 24053619, 24058584, 24060333, 24062209, 24062311, 24067424, 24068253, 24070170, 24071518, 24075202, 24099775, 24100522, 24103091, 24114859, 24121471, 24122391, 24125069, 24127041, 24128438, 24130112, 24130769, 24147030, 24147044, 24160266, 24162157, 24166281, 24166501, 24171864, 24176089, 24185510, 24185512, 24188694, 24192230, 24201803, 24206214, 24217577, 24218030, 24223763, 24225485, 24227889, 24258260, 24260416, 24266697, 24270445, 24282978, 24283290, 24289300, 24289631, 24290378, 24290754, 24296488, 24304542, 24305977, 2430688, 24309997, 24324107, 24324816, 24325915, 24332559, 24333596, 24335340, 24337596, 24366407, 24367492, 24367641, 24375531, 24376209, 24377599, 24388359, 24395109, 24398047, 24413532, 24414391, 24416132, 24425047, 24430361, 24434785, 24440656, 24441042, 24443386, 24447537, 24447935, 24462521, 24463007, 24464625, 24464939, 24467828, 24469035, 24469049, 24475217, 24475282, 24481145, 24481326, 24481452, 24486401, 24486524, 24487689, 24488910, 24495356, 24502950, 24505128, 24510657, 24515104, 24515910, 24520076, 24520381, 24523857, 24529907, 24534923, 24535190, 24552459, 24557447, 24573687, 24583794, 24584939, 24586797, 24595411, 24596201, 24599585, 2460749, 24609850, 24614816, 24615515, 24619425, 24621503, 24634384, 24634415, 24635704, 24637461, 24637950, 24639548, 24667650, 24670917, 24675476, 24678876, 24684682, 24686172, 24692081, 24718280, 24724627, 24735615, 24737323, 24747123, 24747967, 24756215, 24758408, 24771346, 24777335, 24780616, 24785096, 24785256, 24786296, 24789043, 24792166, 24803582, 24815444, 24833090, 24843314, 24852375, 24853384, 24853420, 24858917, 24866769, 24874954, 24876105, 24885022, 24886537, 24887359, 24887419, 24906430, 24908329, 24910535, 24919951, 24924200, 24928087, 24929094, 24947166, 24954507, 24960160, 24970479, 24971610, 24971890, 24973012, 24990559, 24997853, 25005139, 25007960, 25007965, 25028367, 25041824, 25048790, 25063027, 25070479, 25071141, 25072326, 25075030, 25099679, 25100862, 25111287, 25116933, 25120063, 25123150, 25127034, 25135164, 25140630, 25141126, 25149534, 25151293, 25153034, 25153723, 25155268, 25163465, 25168820, 25175082, 25176561, 25178514, 25179840, 25201346, 25209432, 25211228, 25213022, 25218234, 25219498, 25221777, 25223380, 25227710, 25236687, 25241899, 2524651, 25253783, 25258321, 25261645, 25263449, 25269750, 25287073, 25287328, 25288324, 25292288, 25295793, 25298020, 25307233, 25310144, 25316285, 25323936, 25327703, 25337220, 25338319, 25352028, 25367875, 25368386, 25368990, 25370037, 25370469, 25374208, 25388283, 25390939, 25395315, 25401474, 25410484, 25421376, 25421723, 25424702, 25448748, 25450861, 25453096, 25468909, 25476497, 25480943, 25482936, 25488685, 25488809, 25489079, 25503972, 25525332, 25527189, 25527230, 25528056, 25530422, 25531331, 25537643, 25542856, 25556893, 25560734, 25586992, 25592378, 25600243, 25606588, 25607819, 25611337, 25620615, 2562795, 25629224, 25632947, 25633049, 25643697, 25648997, 25651779, 25652255, 25652907, 25657113, 25663546, 25680412, 25681088, 25682200, 25689428, 25712191, 25713166, 25721149, 25725194, 25728338, 25728938, 25730063, 25736597, 25740058, 25740706, 2575000, 25752574, 2576351, 25763854, 25764003, 25770732, 25776849, 25795632, 25801958, 25802405, 25805566, 25810016, 25816016, 25823469, 25833830, 25837259, 25847929, 25848700, 25848861, 25848915, 25849303, 25852060, 25855707, 25857627, 25861752, 25862352, 25871911, 25877889, 25880075, 25881544, 25883093, 25889650, 25892968, 25901081, 25902832, 25904752, 25917453, 25919761, 25923108, 25927974, 25928008, 25928204, 25932962, 25940566, 25956506, 25956916, 25962693, 25972244, 25981900, 25981901, 25987214, 25990368, 25991817, 25992689, 25996148, 25998860, 26006730, 26014809, 26033813, 26036842, 26046126, 26049107, 26049585, 26052094, 26059247, 26067136, 26075823, 26093085, 26096934, 26100284, 26100352, 26115764, 26116361, 26117209, 26122040, 26122181, 26124144, 26125274, 26147891, 26153859, 26158266, 26158350, 26158518, 26160249, 26162914, 26165839, 26166014, 26169690, 26178788, 26179105, 26180042, 26183823, 26183887, 26184135, 26187699, 26199016, 26201402, 26209254, 26215677, 26221067, 26232188, 26251034, 26251419, 26261103, 26272591, 26276891, 26277097, 26277479, 26280679, 26286584, 26297734, 26300005, 26320033, 26330541, 26340863, 26351264, 26364613, 26365581, 26383165, 26385458, 26392082, 26392111, 26395027, 26397135, 26403396, 26404249, 26411678, 26416600, 26426411, 26431674, 26434753, 26434778, 26455641, 26472563, 26487496, 26492917, 26494790, 26500237, 26515727, 26522726, 26529585, 26541420, 26541755, 26552431, 26554309, 26585129, 26590813, 26598706, 26610382, 26610607, 26612860, 26621531, 26621851, 26625804, 26628467, 26631838, 26645832, 26647383, 26648164, 26648459, 26650177, 26657878, 26659386, 26666173, 26670079, 26675256, 26677210, 26681738, 26681740, 26682542, 26683811, 26686064, 26695440, 26704768, 26708273, 26717565, 26740221, 26743380, 26758508, 26771357, 26795347, 26796263, 26796959, 26801869, 26803986, 26805938, 26810571, 26817629, 26821020, 26834106, 26839307, 26845172, 26846986, 26850117, 26857361, 26862065, 26883574, 26887643, 26902609, 26906743, 26909605, 26909792, 26919240, 26920025, 26921331, 26923330, 26928228, 26936396, 26937802, 26947176, 26960396, 26964534, 26971372, 26972162, 26980484, 26980709, 26987290, 27001153, 27005559, 27014911, 27017236, 27020862, 27023311, 27026707, 27028856, 27029552, 27032101, 27035558, 27043307, 27050076, 27052658, 27053251, 27063095, 27065334, 27070141, 27083183, 27100299, 27101408, 27105769, 27107895, 27121061, 27121069, 27129152, 27137076, 27137755, 27141101, 27154416, 27156566, 27159275, 27175587, 27178332, 27179695, 27181204, 27185370, 27185372, 27187039, 27191888, 27197147, 27197157, 27213582, 27225751, 27235162, 27246982, 2725532, 27259233, 27260947, 27264933, 27267999, 27269948, 27277684, 27304060, 27312786, 27313102, 27315045, 27323034, 27340922, 27356714, 27357606, 27365380, 27375289, 27378269, 27380242, 27384237, 27393618, 27432265, 27449149, 27449292, 27456360, 27464521, 27466487, 2747627, 27487152, 27488105, 27489947, 27490758, 27494098, 27499099, 27500741, 27502118, 27508402, 27515002, 2751660, 27525837, 27539025, 27539251, 27542969, 27543265, 27548161, 27561704, 27571262, 27573551, 27575406, 27581354, 27593929, 27597141, 27602955, 27604554, 27619257, 2761986, 27620280, 27640304, 27672107, 27681435, 27683176, 27688475, 27689403, 27702820, 27711920, 27712977, 27713419, 27713477, 27721400, 27721408, 27729416, 27748765, 27749742, 27753535, 27756582, 27756774, 27758888, 27768589, 27775705, 27779649, 27791031, 27792995, 27793424, 27796716, 27796944, 27797974, 27798877, 27809310, 27816721, 27823907, 27825140, 27825388, 27829357, 27832772, 27835577, 27837347, 27841916, 27845892, 27852327, 2785242, 27853906, 27856201, 27856629, 27866092, 27869171, 27870835, 27884978, 27885264, 27888136, 27893709, 27914795, 27921315, 27935770, 27935862, 27941878, 27955963, 27959398, 27964748, 27966906, 27979916, 27986439, 27992601, 27993577, 27995352, 28000426, 28000875, 28005246, 28006062, 28009468, 28012130, 28028927, 28029147, 28029312, 28035371, 28040694, 28045625, 28049591, 28055972, 28057046, 28060723, 28060751, 28068355, 28069384, 28070831, 28076334, 28079144, 28082280, 28087261, 28096479, 28103111, 28103936, 28106301, 28108260, 28108626, 28111258, 28112739, 28114999, 28120435, 28131840, 28147342, 28148288, 28148690, 28153508, 28153880, 28159748, 28173783, 28174265, 28177081, 28177907, 28178648, 28182136, 28192639, 28199328, 28209156, 28214052, 28215104, 28216037, 28216163, 28216286, 28221191, 28223545, 28224609, 28235894, 28236033, 28238967, 28240737, 28243121, 28243897, 28249728, 28253895, 28254786, 28260926, 28262792, 28263391, 28266545, 28266626, 28270497, 28270510, 28270739, 28271747, 28272775, 28274582, 28275030, 28276317, 28280092, 28281842, 28285967, 28288134, 28293912, 28296398, 28301080, 28301514, 28301550, 28319069, 28320353, 28322778, 28331366, 28332606, 28334272, 28336670, 28337664, 28341383, 28341599, 28342866, 28344099, 28344890, 28347547, 28348059, 28355428, 28360138, 28362679, 28367091, 28373182, 28374222, 28376175, 28379297, 28382093, 28383555, 28388952, 28389808, 28396197, 28396978, 28400477, 28412323, 28415602, 28415616, 28416776, 28419445, 28423537, 28423597, 28423635, 28423644, 28427202, 28427429, 2842775, 28430630, 28432361, 28433540, 28442559, 28454423, 28455002, 28460819, 28463089, 28464832, 28466123, 28467815, 28470951, 28472544, 28472954, 28473534, 28475868, 28476032, 28481366, 28486103, 28489882, 28490348, 28490933, 28493933, 28495849, 28498416, 28506582, 28507152, 28514748, 28515148, 28520140, 28526959, 28529458, 28529618, 28534357, 28534508, 28535794, 28545469, 28560596, 28565873, 28567703, 28570501, 28573436, 28576130, 28577281, 28577282, 28588725, 28589367, 28591870, 28595965, 28599421, 28601929, 28607590, 28610873, 28611039, 28614911, 28615518, 28618207, 28624063, 28625568, 28632174, 28632792, 28640531, 28642035, 28643774, 28644496, 28646740, 28657320, 28659298, 28662179, 28667103, 28669713, 28671018, 28687497, 28689363, 28690652, 28692043, 28692125, 28696357, 28698102, 28700487, 28705918, 28708432, 28712925, 28714517, 28714765, 28717100, 28724364, 28724391, 28724435, 28729413, 28734944, 28741260, 28744736, 28744792, 28751448, 28751463, 28755608, 28756019, 28756535, 28760601, 28761973, 28766214, 28769019, 28776283, 28779705, 28784863, 28786813, 28789340, 28789417, 28789451, 28791495, 28791684, 28794284, 28799536, 28801307, 28808484, 28809778, 28810691, 28813638, 28814897, 28825224, 28828583, 28830573, 28839265, 28842253, 28844015, 28844711, 28845177, 28845597, 28847747, 28858267, 28861319, 28869838, 28870904, 28874413, 28875243, 28877752, 28877935, 28881748, 28885360, 28891935, 28899409, 28901319, 28904064, 28910567, 28912152, 28916342, 28919786, 28924522, 28927269, 28942113, 28943990, 28947133, 28957356, 28957821, 28961844, 28962900, 28968398, 28968647, 28969000, 28974548, 28975625, 28979134, 28984209, 28986287, 28988130, 28993511, 28993998, 29021233, 29029116, 29029636, 29031688, 29033607, 29035379, 29036268, 29039577, 29040973, 29045135, 29045526, 29045530, 29050248, 29051317, 29051735, 29058716, 29069787, 29069872, 29074358, 29078133, 29087485, 29096683, 29096893, 29100376, 29109797, 29110491, 29128895, 29131020, 29133365, 29137314, 29137354, 29141657, 29141994, 29144542, 2915647, 29156699, 29156828, 29157627, 2915900, 29162724, 29166868, 29168063, 29175422, 29176653, 29180066, 29180470, 29187405, 29188531, 29189179, 29192207, 29197120, 29198894, 29202609, 29202611, 29216929, 29219225, 29228577, 29229933, 29230662, 29232439, 29234247, 29234306, 29241203, 29241890, 29243782, 29252036, 29254147, 29254480, 29260362, 29261141, 29262572, 29263157, 29263188, 29269484, 29276409, 29278880, 29285606, 29289555, 29291017, 29292214, 29300901, 29306943, 29307843, 29312586, 29312618, 29318276, 29320459, 29326587, 29330437, 29332343, 29339359, 29342211, 29342868, 29343615, 29343814, 29344249, 29345254, 29348811, 29349448, 29351904, 29352368, 29353824, 29353882, 29360925, 29361175, 29363543, 29368311, 29371858, 29373839, 29375380, 29378668, 29383138, 29385066, 29393914, 29401647, 29409530, 29414691, 29416786, 29416796, 29420220, 29423119, 29433542, 29436614, 29436642, 29436922, 29438688, 29438694, 29444670, 29451783, 29453314, 29462880, 29464534, 29466767, 29467493, 29478216, 29482551, 29483206, 29502324, 29513571, 29518546, 29525735, 29528718, 29530940, 29531247, 29541976, 29543921, 29550845, 29553968, 29554462, 29554473, 29557271, 29562737, 29572677, 29574860, 29578175, 29581135, 29587221, 29587339, 29587674, 29587753, 29588602, 29599329, 29602822, 29614078, 29615433, 29625565, 29633513, 29636357, 29636363, 29662238, 29665550, 29665866, 29666928, 29670855, 29673111, 29673760, 29674510, 29678492, 29684479, 29685157, 29687853, 29691722, 29692688, 29695586, 29700127, 29702197, 29702977, 29707142, 29708591, 29709338, 29713854, 29715116, 29718790, 29720215, 29733910, 29737472, 29738697, 29740030, 29741562, 29743443, 29745079, 29748621, 29753772, 29759595, 29761323, 29762200, 29763858, 29763890, 29769099, 29772460, 29772517, 29777335, 29789325, 29802348, 29805656, 29842969, 29843638, 29845295, 29848291, 29852797, 29854295, 29858579, 29860984, 29873413, 29877575, 29880014, 29885789, 29893332, 29895970, 29898754, 29899079, 29901116, 29915250, 29922922, 29928444, 29931061, 29931120, 29934505, 29935166, 29935374, 29935900, 29937544, 29940022, 29945962, 29959421, 29963233, 29964355, 29965793, 29970021, 29970713, 29972720, 29973879, 29975948, 29979736, 29987050, 29991605, 29996906, 30006796, 30013179, 30013390, 30014897, 30016454, 30019586, 30021371, 30036253, 30038216, 30038716, 30040982, 30041599, 30042681, 30052783, 30054830, 30057418, 30061207, 30082476, 30086626, 30087072, 30089255, 30097312, 30100993, 30102524, 30103729, 30107476, 30108709, 30115027, 30120700, 30121621, 30123125, 30128071, 30128181, 30132794, 30133331, 30137688, 30138940, 30139383, 30143015, 30143553, 30145202, 30149225, 30151737, 30153467, 30154572, 30155484, 30158597, 30173322, 30175120, 30177834, 30177835, 30177847, 30179118, 30179299, 30180594, 30180878, 30181360, 30182339, 30183988, 30184043, 30186165, 30190545, 30191958, 30194396, 30195206, 30208353, 30208932, 30213797, 30214302, 30218195, 30221739, 30226366, 30226541, 30226592, 30229539, 30229826, 30230095, 30230113, 30230580, 30232064, 30232143, 30233207, 30241942, 30247957, 30248461, 30250021, 30252931, 30258538, 30261866, 30262864, 30262900, 30265334, 30277539, 30278072, 30284735, 30286765, 30289755, 30290658, 30293712, 30299291, 30301163, 30301189, 30307542, 30315000, 30315184, 30315845, 30319540, 30321870, 30324422, 30324661, 30324876, 30326622, 30326937, 30328006, 30334368, 30338035, 30338425, 30347895, 30358192, 30361903, 30365135, 30367332, 30373175, 30373552, 30375428, 30382472, 30387004, 30388713, 30388728, 30389467, 30391994, 30395264, 30399599, 30404440, 30404658, 30410061, 30411431, 30412247, 30414939, 30415143, 30418174, 30419347, 30430577, 30445651, 30450577, 30450651, 30454027, 30457555, 30458661, 30458882, 30463022, 30497079, 30498869, 30500622, 30509329, 30513833, 30515770, 30519041, 30523750, 30531871, 30532215, 30535478, 30537512, 30538543, 30542717, 30542725, 30543347, 30546460, 30547831, 30560461, 30570850, 30573685, 30577860, 30579865, 3058236, 30583472, 30587150, 30587451, 30591472, 30591548, 30594038, 30597041, 30597111, 30598194, 30604153, 30616080, 30617282, 30620711, 30621641, 30622040, 30631046, 30631150, 30636932, 30640465, 30642093, 30642351, 30646517, 30647855, 30651078, 30655322, 30655324, 30655757, 30655876, 30655946, 30658681, 30659843, 30663337, 30675245, 30675282, 30679303, 30680514, 30687231, 30689838, 30691046, 30691108, 30694768, 30697064, 30707565, 30716576, 30718918, 30720225, 30733228, 30734152, 30736096, 30736340, 30737644, 30737679, 30742607, 30759864, 30760519, 30763068, 30771221, 30775443, 30777364, 30779932, 30782165, 30782572, 30783737, 30784287, 30796353, 30798422, 30806044, 30813337, 30813351, 30821186, 30822713, 30823890, 30824542, 30830488, 30831601, 30833174, 30833270, 30838840, 30840889, 30841783, 30842152, 30845378, 30847396, 30848213, 30850489, 30851122, 30851384, 30854047, 30855679, 30859501, 30861567, 30862719, 30866861, 30867801, 30869771, 30875375, 30904591, 30908519, 30915533, 30915662, 30920963, 30921201, 30935371, 30937657, 30939353, 30939535, 30943409, 30944014, 30944027, 30952631, 30954508, 30956778, 30962496, 30968114, 30968961, 30970003, 30971760, 30972198, 30978702, 30982901, 30987380, 30995757, 31000690, 31002359, 31007067, 31011629, 31012189, 31028134, 31029427, 31036830, 31038398, 31041737, 31041982, 31073170, 31081218, 31084623, 31087784, 31087799, 31088482, 31090264, 31092464, 31095738, 31099456, 31100617, 31110002, 31112577, 31113820, 31115881, 31120152, 31120565, 31124298, 31125586, 31129450, 31144206, 31152079, 31152137, 31158411, 31166208, 31167163, 31169691, 31173262, 31175940, 31178825, 31186766, 31187481, 31188645, 31190183, 31190337, 31192530, 31195751, 31197914, 31204155, 31205415, 31210014, 31210440, 31212042, 31213826, 31219612, 31222709, 31226312, 31231467, 31236323, 31257479, 31260937, 31269432, 31276668, 31277939, 31281726, 31284080, 31289516, 31297554, 31302113, 31318440, 31319040, 31331001, 31331091, 31336602, 31339372, 31340200, 31342369, 31358030, 31359833, 31362937, 31367884, 31372638, 31384394, 31385051, 31387918, 31390833, 31395589, 31395685, 31401293, 31402403, 31406251, 31408468, 31409371, 31415823, 31416135, 31419991, 31422497, 31427580, 31428575, 31430979, 31431634, 31440208, 31440781, 3145027, 31451564, 31452755, 31456186, 31456192, 31463793, 31476594, 31479306, 31496995, 31502168, 31515643, 31518595, 31518603, 31531802, 31534012, 31545499, 31545985, 31547956, 31548345, 31551181, 31551256, 31555578, 31557516, 31559573, 31561604, 31562548, 31562570, 31562808, 31572437, 31574930, 31576449, 31578396, 31588183, 31588232, 31588558, 31588803, 31590382, 31595181, 31595691, 31601121, 31601247, 31603096, 31604113, 31605532, 31619506, 31627219, 31630379, 31636386, 31640622, 31644911, 31647839, 31647985, 31649747, 31657853, 31665670, 31669227, 31669266, 3167228, 31678519, 31683895, 31686835, 31689473, 31701491, 31708649, 31715186, 31721572, 31729597, 31731733, 31732674, 31734822, 31742342, 31746305, 31749762, 31767794, 31769341, 31769419, 31779655, 31781337, 31786415, 31786857, 31795152, 31804159, 31807179, 31811486, 31811505, 31812165, 31821370, 31823286, 31838731, 31839155, 31839713, 31842789, 31845230, 3224823, 3290209, 3321071, 3390830, 3463818, 3502607, 3607757, 3677099, 6839301, 7514626, 7538900, 7577702, 7579493, 7581411, 7607570, 7628351, 7629697, 7646066, 7647336, 7664983, 7690042, 7708056, 7720671, 7812959, 7819270, 7851874, 7861463, 7903907, 7913659, 7914825, 7916651, 7922981, 7954259, 8043496, 8050081, 8095168, 8101763, 8133533, 8157081, 8168078, 8219249, 8219252, 8219253, 8219254, 8239493, 8261397, 8261406, 8261407, 8275466, 8314777, 8368130, 8419924, 8439515, 8440747, 8499331, 8504763, 8600466, 8603051, 8603400, 8609661, 8614006, 8614007, 8622078, 8625307, 8636345, 8649771, 8722747, 8758927, 8764133, 8798658, 8813116, 8918973, 8919544, 8932874, 8940394, 9009243, 9010238, 9010317, 9010318, 9010319, 9014838, 9032254, 9041202, 9044830, 9065812, 9066618, 9067542, 9075708, 9102207, 9103405, 9113991, 9131272, 9131589, 9137105, 9158695, 9168006, 9199297, 9204213, 9247911, 9269899, 9270016, 9276643, 9328285, 9359472, 9360842, 9367686, 9371489, 9393947, 9400029, 9409287, 9415404, 9422519, 9436640, 9443393, 9449239, 9495357, 9538123, 9539249, 9544822, 9558715, 9570382, 9570831, 9592198, 9628887, 9658402, 9662379, 9673390, 9699869, 9699871, 9705075, 9706140, 9713824, 9723886, 9731492, 9772278, 9786916, 9790916, 9815641, 9815758, 9815968, 9816234, 9816251, 9823305, 9823320, 9850080, 9852397, 9877030, 9879662, 9889290		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CLINVAR_DG	10945602, 16280033, 17545528, 17553133, 23236557		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17417639, 20104649, 20458558, 20966540, 21501481, 21541733, 22038807, 22174584, 23001124, 24014025, 24185510, 24185512, 25330770, 27580430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	22976474		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10415108, 10612426, 10753195, 11207052, 11603221, 11698343, 11751515, 12055672, 12088871, 12138194, 12270131, 12943742, 12962933, 12970323, 14645498, 15149734, 16093440, 16567092, 16596174, 16690106, 16809439, 17170081, 17434921, 18292933, 18788074, 18937711, 18990228, 19088370, 19160418, 19319135, 19371625, 19432902, 19438492, 20012305, 20126312, 20381444, 20596625, 21048224, 21139866, 21272446, 21363919, 21802511, 21878365, 22025313, 22075757, 22139444, 22325788, 22404101, 22415229, 22876322, 23051957, 23306391, 23593326, 23688837, 24039841, 25766326, 25884434, 26330482, 26395027, 26428028, 26957478, 27018308, 27033325, 27197147, 27342949, 27527851, 27696906, 27870712, 27888807, 27974701, 28052940, 28382516, 28454369, 28476021, 28540420, 28578502, 28978098, 29085506, 29207611, 29300901, 29331043, 29406446, 29539426, 29636868, 29665555, 29799481, 30057548, 30127640, 30420335, 30586414, 30616900, 30706380, 30779215, 31140648, 31220580, 31330844, 31362937, 31395281, 31576449, 31686835, 31778358, 31796030, 7542977, 7784019, 8344199, 9393947, 9738013		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	22808109, 25066711		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30885958		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	24604205, 29274403		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	16712894		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31400761		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10435640, 11911952, 15161576, 15986439, 16603640, 18949413, 21498706, 21524465, 22985911, 23608817, 23696246, 24651077, 25277535, 26301798, 27572263, 28693248, 28783064, 29233790, 30684567		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	11872642, 17077188		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	30715409, 31228270		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10720062, 10838500, 11489814, 12782587, 12960427, 16176503, 16245302, 17535880, 18165403, 18690166, 19675076, 19749010, 20056644, 21102415, 22092403, 22351618, 22549810, 22896656, 2306733, 23095717, 23390495, 23402742, 23580092, 23677930, 24171864, 24376209, 24410765, 24466274, 24481591, 24604205, 24908329, 25221777, 25825714, 26797759, 26871282, 28073843, 28225892, 28264438, 28376175, 28859612, 29137401, 29157627, 29196616, 29807696, 29885789, 30302736, 31041737, 31077012, 31227223, 31495455, 8541224, 9252329, 9605408, 9655254, 9816163, 9850067		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11448539, 19020750, 30373552		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10676656, 10960840, 11096250, 11179905, 11244506, 11280747, 11536308, 11595700, 11752866, 11782371, 11855735, 11948106, 12122114, 12606125, 12891629, 14499686, 14755680, 15161636, 15358197, 15986439, 16099479, 16406987, 16551880, 17176215, 17525739, 17598908, 17606710, 17649823, 17879940, 17908481, 18006911, 18952763, 19126643, 19189301, 19250214, 19505920, 19654868, 19904497, 19952760, 20184087, 20615892, 21106711, 22228197, 22403175, 22508765, 22549291, 22593181, 23028063, 23098495, 23135751, 23186779, 23737135, 23805288, 24171864, 24374826, 24414486, 24584714, 24859835, 25080090, 25369892, 25409762, 25415230, 25436982, 25828708, 25931004, 26010887, 26124144, 26251204, 26547439, 26575018, 26803986, 27259327, 27696457, 27776343, 27979317, 28115406, 28147335, 28353585, 28667081, 28721070, 29094395, 29249638, 29254246, 29360794, 29455003, 29654831, 29662238, 29984337, 30018975, 30223929, 30555629, 30904591, 30918758, 31054895, 31108117, 31125586, 8722747, 9266239		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16220300, 17176215		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	14767512, 20087349, 20339947, 20514458, 22093877, 23843035, 23918832, 27459504, 28983626, 29090670, 29210057, 29805694, 31452712, 31454993		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	19207611, 24171864, 7742719		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21142662, 27064865, 31790688		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	16712894		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24148819, 25277204, 27092883, 29567231, 30511377, 30737158, 31455760		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10371344, 10379891, 10551786, 10815765, 10854714, 11096250, 11133808, 11344205, 11494058, 11533059, 12051868, 12198596, 12208729, 12611455, 12615709, 12714703, 12782587, 14739056, 14981916, 15163307, 15623657, 15642159, 15709176, 15871703, 15880569, 16095634, 16119004, 16244359, 16502042, 16617564, 16773633, 16849584, 17001676, 17032447, 17143524, 17215075, 17279547, 17309937, 17417639, 17457609, 17850661, 17915203, 17951536, 18533032, 18542073, 18593987, 18628976, 18637494, 19021634, 19082709, 19207611, 19364972, 19575750, 19738052, 19762336, 19859802, 19887647, 20080630, 20228131, 20234815, 20383761, 20482849, 20570923, 20739888, 20805453, 21069581, 21092249, 21212030, 21344391, 21396117, 21552212, 21641572, 21700719, 21707866, 21766210, 21809392, 21812955, 21825015, 21947828, 22053771, 22102431, 22264274, 22291085, 22404099, 22418568, 22429463, 22543280, 22720981, 22812573, 23001124, 23028063, 23086814, 23136140, 23158478, 23346221, 23374155, 23390495, 23442322, 23467929, 23515291, 23535731, 23535825, 23542418, 23707618, 23722551, 23723333, 23861811, 23865427, 23875016, 23986557, 24062209, 24107627, 24142535, 24160266, 24185510, 24215441, 24225485, 24286852, 24374826, 24447537, 24604205, 24715036, 24957076, 25063027, 25100862, 25168820, 25200861, 25228280, 25230850, 25404424, 25451689, 25583948, 25598430, 25613069, 25622979, 25732226, 25763854, 25778331, 25990368, 26046126, 26056290, 26070963, 26169690, 26225806, 26235388, 26339626, 26372732, 26524723, 26560360, 26575018, 26618344, 26645718, 26771357, 26796959, 26810571, 26826118, 26856771, 27018308, 27121061, 27139182, 27141101, 27172895, 27187039, 27272795, 27291250, 27368476, 27376509, 27384237, 27384485, 27504960, 27557932, 27573551, 27689466, 27696906, 27735826, 27756774, 27779689, 27821721, 27859250, 27867016, 27888807, 27921315, 28011460, 28040694, 28152150, 28176013, 28211214, 28253390, 28263391, 28270510, 28315369, 28399853, 28480526, 28489591, 28495849, 28529618, 28578502, 28586788, 28602413, 28614911, 28644496, 28692043, 28729413, 28763032, 28784863, 28799536, 28861689, 28877935, 28980721, 28982874, 28983626, 28993056, 29028222, 29137401, 29180470, 29188531, 29207611, 29289555, 29342868, 29362448, 29383298, 29436614, 29438688, 29471794, 29477637, 29552303, 29554473, 29555527, 29588602, 29718790, 29745079, 29789325, 29807696, 29848684, 29910644, 29935374, 29945962, 29963013, 29979736, 29998468, 30025900, 30053090, 30057548, 30072192, 30145202, 30183375, 30196538, 30221357, 30226592, 30278574, 30375428, 30413161, 30420335, 30456680, 30468654, 30534999, 30538543, 30616080, 30655341, 30691046, 30731397, 30763392, 30846407, 30869771, 30878502, 30911948, 30915533, 30944014, 30987772, 30993643, 31000690, 31028134, 31077012, 31090264, 31226956, 31257479, 31281734, 31289559, 31303470, 31307414, 31327134, 31348739, 31372638, 31452755, 31452808, 31502168, 31518875, 31523634, 31556460, 31590917, 31592814, 31655316, 31655896, 31689473, 31708873, 31767794, 7351012, 8123866, 8156519, 8219254, 8910626, 8912864, 9321654, 9699869		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21075781		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	19207611, 22245602, 24171864, 7742719		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15361203, 19047174, 20581058, 24511005, 26056290, 28472813, 28924735, 29229929, 30173650, 30957588, 31452755		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11212261, 16820927, 18225578, 21088384, 21161820, 25683270, 29451783, 29605850, 31121307		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17417639, 20104649, 20458558, 20966540, 21501481, 21541733, 22038807, 22174584, 23001124, 24014025, 24185510, 24185512, 25330770, 27580430		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	20305694, 6288225		★☆☆☆☆ Found in Text Mining only
Mammary Ductal Carcinoma	Marfan Syndrome	BEFREE	15692763		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10022773, 10070900, 10101196, 10199781, 10319328, 10328849, 10379891, 10519397, 10551786, 10602504, 10630402, 10699900, 10752676, 10791772, 10815765, 10819506, 10822014, 10836298, 10845812, 10913246, 10936613, 11042568, 11084868, 11103781, 11245479, 11376135, 11400682, 11533059, 11559546, 11562467, 11687975, 11693462, 11711119, 11857292, 11879565, 11897507, 11911263, 11916237, 12208864, 12462383, 12466974, 12479697, 12579315, 12589939, 12644823, 12752624, 12817998, 1362141, 1382838, 14515009, 14570715, 14580259, 14613024, 15062564, 15084249, 15111769, 15126326, 15149721, 15345050, 15358790, 15361840, 15466169, 15470903, 15623657, 15825149, 15837734, 15846392, 15890247, 15930283, 15941968, 16033821, 16103452, 16168121, 16280033, 16298037, 16455819, 16585219, 16740744, 16778215, 16849553, 16880783, 16885386, 16941532, 16945990, 17047081, 17050554, 17089000, 17158757, 17158759, 17259347, 1728420, 17297453, 17550982, 17553133, 1756270, 17616674, 17617929, 17634531, 17660348, 17700572, 17896177, 17909269, 17914099, 17975003, 18000219, 18006915, 18026833, 18079323, 18245484, 18299979, 18310281, 18371219, 18445275, 18451179, 18473934, 18476782, 18481172, 18485221, 18501937, 18563553, 18629630, 18647968, 18755890, 18757322, 18787018, 18922159, 18928543, 19047159, 19047897, 19064549, 19075277, 19250200, 19264808, 19276159, 19276248, 19366906, 19505923, 19626437, 19738052, 19771505, 19799609, 19852955, 1988075, 19882362, 19898421, 19904759, 20052536, 20054642, 20104523, 20109227, 20145118, 2018347, 20388878, 20427689, 20432175, 20460512, 20484027, 20490652, 20550710, 20569503, 20581046, 20659323, 20663877, 20689759, 20705611, 20878674, 20930115, 20935677, 21078168, 21174060, 21209903, 21343398, 21396117, 21403841, 21458421, 21465167, 21640702, 21655924, 21680538, 21680658, 21695171, 21754991, 21789246, 21830868, 21868451, 21878535, 21947828, 2194831, 22018777, 22027149, 2206558, 22079037, 22083956, 22086908, 22113133, 22144499, 22279038, 22301780, 22457607, 22492511, 22559974, 22608253, 22616702, 22751119, 22807578, 22850893, 22879364, 22918168, 22926442, 22963885, 2302226, 23098526, 23142699, 23172894, 23203101, 23216744, 23325583, 2332903, 23344024, 23390068, 23467929, 23499324, 2354445, 23568502, 23624936, 2364377, 23664836, 23723333, 23810005, 24013225, 24027428, 24185512, 24210818, 24265722, 24368439, 24413080, 24431073, 24488910, 24586797, 2459605, 24678876, 24758297, 24786296, 24789043, 24839032, 24874954, 24887419, 24954507, 24960160, 24973012, 25135164, 25211228, 25215559, 25283550, 25351767, 25384218, 25420785, 25583948, 25586992, 25607819, 2562795, 25655427, 25663546, 25687182, 25695958, 25716347, 2576351, 25802405, 25875093, 25877889, 25927974, 25971960, 25991817, 26014809, 26026468, 26052094, 26080803, 26141719, 26142905, 26153859, 26183823, 26183887, 26186233, 26215677, 26235388, 26247365, 26271713, 26385458, 26695440, 26715507, 26909605, 26987290, 27020862, 27107895, 2725532, 27277684, 27341075, 27393618, 27491861, 27535130, 27542969, 27551012, 27581354, 27612429, 27666130, 27729460, 27730215, 27756582, 27764788, 2785242, 27905104, 27927249, 27988896, 27993329, 28108518, 28320353, 28396978, 28411130, 28429243, 28429725, 28430646, 28450563, 28457730, 28468594, 28537895, 28692125, 28766230, 28855612, 28870906, 28947133, 28975433, 28993511, 29029116, 29100336, 29145974, 29147603, 29181007, 29212519, 29254284, 29320557, 29339455, 29349448, 29350274, 29353883, 29593009, 29593425, 29680858, 29743060, 29772517, 29791862, 29796183, 29901116, 29931061, 29937544, 29981282, 29996906, 30042681, 30061207, 30061623, 30133331, 30327501, 30387004, 30410061, 30472020, 3047554, 30513833, 30524905, 30546463, 30575334, 30597041, 30645633, 30655323, 30665944, 30692633, 30695671, 30779932, 30806044, 30833270, 30859501, 30940549, 30987380, 31110002, 31121213, 31146345, 31231467, 31289559, 31463793, 31518603, 31562691, 31742342, 7589776, 7629697, 7861463, 7878527, 7906679, 7913659, 7958984, 8043496, 8219254, 8219256, 8252481, 8261406, 8261407, 8275466, 8439515, 8609661, 8614007, 8636345, 8640788, 8722747, 8812487, 8813116, 8878453, 9010317, 9028531, 9056208, 9065812, 9131272, 9137083, 9137105, 9247911, 9270016, 9397958, 9449245, 9538117, 9570831, 9581827, 9635570, 9673394, 9685228, 9772278, 9815889, 9833771, 9865902		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11839580, 12088102, 12242035, 12594813, 12750288, 12775708, 12821935, 12855746, 14504194, 14715875, 14973389, 14981916, 15056731, 15161711, 15254780, 15254972, 15282324, 15467744, 15532726, 15591788, 15595626, 15637147, 15642162, 15694360, 15709176, 15723135, 15798095, 15802375, 15842934, 15856463, 16055089, 16091743, 16118406, 16119004, 16168103, 16168121, 16215870, 16219765, 16226051, 16280033, 16455819, 16492926, 16502042, 16555127, 16636675, 16645043, 16647340, 16679312, 16684779, 16769725, 16791593, 16799708, 16808847, 16912174, 16954434, 17187234, 17203178, 17252199, 17312270, 17333335, 17415682, 17463000, 17473282, 17545528, 17553133, 17562079, 17594514, 17599361, 17616709, 17617929, 17666584, 17761946, 17904846, 17908967, 17960587, 18037997, 18042273, 18184269, 18216219, 18229450, 18252198, 18264135, 18271972, 18301357, 18365014, 18372406, 18379196, 18388150, 18391223, 18451179, 18483257, 18483465, 18485221, 18518979, 18534028, 18550720, 18550772, 18558727, 18577416, 18593897, 18593923, 18593928, 18615623, 18632615, 18708366, 18720524, 18755890, 18798271, 19021634, 19074826, 19237581		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17417639, 20104649, 20458558, 20966540, 21501481, 21541733, 22038807, 22174584, 23001124, 24014025, 24185510, 24185512, 25330770, 27580430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CLINVAR_DG	24185510, 24185512, 24398047		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17417639, 20104649, 20458558, 20966540, 21501481, 21541733, 22038807, 22174584, 23001124, 24014025, 24185510, 24185512, 25330770, 27580430		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	24162157		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17951536		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19008315, 22439007, 22454254, 25885794, 28877739		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16818643, 18020983, 21745488, 27378491, 27535130, 28467693, 28524047, 29130512, 29336307, 31355620, 31696058		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16818643, 28026870, 37251404	Associate	★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	28353608	Associate	★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	31608530		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	23352976		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10421067, 10704905, 18980792, 2213164, 2703268, 28820306, 30031954, 7581411, 8499331, 9311583, 9397958		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	33342817	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	21804148, 22051074, 22205149, 22901010, 26169989, 26620113, 28544903, 28716632, 28890035, 29263188, 29303703, 29447376, 29549264, 29636617, 29996916, 30500622, 31790664, 31823143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22051074, 22094188, 22205149, 22901010, 24133901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	12627470, 15576061, 22124532, 30402099		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	15639718, 17659810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	28414091		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	17659810, 27529370	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	CTD_human_DG	18505767		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	30974146		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26370976, 28763032, 30217154	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	16949391, 17513703, 17854418, 19032032, 22011627, 23809427, 24140101, 26370976, 26647383, 28119607, 29740325, 29883973, 30005878, 30049354, 30217154		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	17649823		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	15133719, 15654614, 16179580, 16361951, 16504171, 17116097, 17609999, 19093296, 19175383, 19673915, 20959426, 22511967, 23674830, 24698360, 26334887, 27778160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	LHGDN	15133719, 16361951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	CTD_human_DG	15133719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	Pubtator	16504171, 22511967	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Migraine with Aura	BEFREE	17116097, 19093296, 19673915, 22511967		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	22511967	Associate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22311091		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	17895504, 19200973, 20884142, 31786857, 8333417		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	31758431		★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	29532268		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18449864, 20616674, 22901010, 30544539		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	18449864, 20616674, 22901010, 23917948		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Diseases	Mouth disease	Pubtator	16210018	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	21781458	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	11342781		★☆☆☆☆ Found in Text Mining only
Mucinous carcinoma of breast	Mucinous Carcinoma Of Breast	BEFREE	30649385		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	25749557, 31493782		★☆☆☆☆ Found in Text Mining only
Multifocal breast carcinoma	Multifocal breast carcinoma	BEFREE	31731733		★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	27034161		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	27034161		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11429412, 9716605	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15655377, 16497877, 19548309		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11054488, 12098513, 12098649, 17109894, 24171864, 29957391		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23894347, 24171864, 25820259, 34877984, 36254093	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	30241506	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	15661863, 19793653		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	LHGDN	15661863		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	15661863	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	21286011		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21286011	Inhibit	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	15314222, 31226894		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17900262, 28599273		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	21499302, 24684682, 26487496, 28209156, 30848213		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12824724, 14600184, 15213208, 16014638, 16203927, 16484614, 17558892, 19556726, 19608186, 20599431, 22061094, 26258537, 29283052, 30036658		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	14600184		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	14600184		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	16484614, 18165171, 19556726	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	15213208, 16014638, 18309176, 28292026		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	26422690	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	29201031, 30017519		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	36478205	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	26077347, 28634856		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20473931, 28893862		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20473931, 32448862	Associate	★☆☆☆☆ Found in Text Mining only
Native American myopathy	Native american myopathy	Pubtator	32926435	Associate	★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	36401732	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	19898421	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	23992566	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10022773, 10023003, 10371344, 10389938, 10419456, 10482202, 10504548, 10519397, 10542944, 10551786, 10554010, 10639512, 10639513, 10667568, 10713656, 10717624, 10718209, 10720062, 10746681, 10786679, 10791770, 10815929, 10819506, 10819507, 10822014, 10845812, 10850416, 10861509, 10887484, 10913246, 10915729, 11042568, 11051252, 11060337, 11072781, 11081187, 11102317, 11102895, 11106244, 11108660, 11186170, 11221879, 11280747, 11331294, 11376135, 11384768, 11391625, 11400119, 11400682, 11410514, 11429696, 11445874, 11448539, 11448907, 11533059, 11555606, 11603221, 11676860, 11693462, 11705859, 11711119, 11731426, 11731427, 11782356, 11786932, 11812086, 11826915, 11836618, 11857292, 11872285, 11888893, 11911952, 11916237, 11929326, 11948466, 11971868, 11974557, 12037682, 12038703, 12125913, 12140138, 12154049, 12160997, 12168876, 12208864, 12360043, 12429812, 12462383, 12479697, 12527894, 12529347, 12538500, 12547149, 12559041, 12560434, 12584572, 12602927, 12631589, 12644824, 12680217, 12727813, 12782587, 12789259, 12790787, 12793903, 12796397, 12817998, 12917485, 12938930, 1345763, 1381277, 1382838, 14507640, 14515009, 14517345, 14519755, 14555521, 14580261, 14608539, 14633738, 14645421, 14654938, 14682440, 14703066, 14710227, 14715875, 14758095, 14760071, 1498488, 14985456, 15012604, 15015704, 15016320, 15041722, 15044858, 15073102, 15073846, 15075668, 15094777, 15126326, 15161636, 15163307, 15171723, 15183540, 15274325, 15318931, 15345050, 15358197, 15364883, 15369451, 1548522, 15492288, 15501975, 15520168, 15521105, 15536519, 15547533, 15574760, 15591335, 15609121, 15619212, 15668953, 15683469, 15701881, 15701882, 15709182, 15742416, 15743500, 15788661, 15824740, 15837734, 15867229, 15886208, 15894660, 15941968, 15982396, 15990899, 15999367, 16021574, 16095634, 16103451, 16103452, 16140974, 16166329, 16168103, 16211220, 16216906, 16261164, 16280036, 16287071, 16297090, 16317585, 16319978, 16322213, 16328721, 16357129, 16361578, 16408291, 16417653, 16478745, 16489054, 16489075, 16505416, 16507410, 16527605, 16530420, 16551856, 16563182, 16568452, 16569260, 16570270, 16585219, 16609009, 16626501, 16645950, 16673816, 16721725, 16730717, 16737553, 16740749, 16740753, 16752221, 16809759, 16826462, 16846527, 16849553, 16849564, 1690316, 16944977, 16954440, 16985023, 16998594, 17014703, 17047084, 17050554, 17062636, 17069650, 17076897, 17078870, 17143524, 17150101, 17163411, 17163418, 1722871, 17255267, 17261753, 17279547, 17308270, 17317819, 17332319, 1737370, 1740681, 17417639, 17452977, 17471242, 17477366, 17487280, 17493263, 17529974, 1756266, 17575221, 17580278, 17593529, 17596595, 17596930, 17646931, 17663001, 17700572, 17872899, 17885670, 17894856, 17911387, 1791843, 17921385, 17925008, 17947490, 17951401, 17954712, 17973251, 17993718, 17999690, 18000219, 18006915, 18020983, 18026833, 18043286, 18078353, 18089803, 18094411, 18224391, 18226260, 18240019, 18245484, 18297396, 18310281, 18327638, 18340528, 18371219, 18381935, 18409153, 18414193, 18416850, 18425577, 18438407, 18446835, 18451176, 18465330, 18483177, 18483329, 18485221, 18514188, 18542073, 18612148, 18628471, 18631401, 18632608, 18647968, 18690166, 18712725, 18714348, 18752184, 18804516, 18820009, 1883387, 18843012, 18843021, 18922159, 18945339, 18958632, 18971781, 18980792, 19011961, 19016350, 19020750, 19028704, 19036156, 19047159, 19067762, 19082494, 19083478, 19124506, 19138995, 19147748, 19148895, 19156836, 19167496, 19188147, 19207611, 19224856, 19225562, 19252821, 19258481, 19270750, 19272155, 19276248, 19320640, 19323294, 19330030, 19347827, 19358266, 19372579, 19380452, 19385968, 19435893, 19444933, 19451693, 19491275, 19533338, 19546226, 19549254, 19574781, 19582160, 19626437, 19631282, 19675076, 19690183, 19733896, 19744330, 19749010, 19760501, 19771505, 19771508, 19789341, 1979748, 19799609, 19845944, 19860576, 19861523, 1988075, 19896697, 19898223, 19898421, 19946334, 19949674, 19955335, 19966015, 20020198, 20025731, 20042638, 20056651, 20080637, 20087860, 20109227, 20133251, 20140701, 20140702, 20149218, 20151982, 20213080, 20215536, 20228131, 20234815, 20237034, 20308648, 2035527, 20403033, 20404251, 20419820, 20437200, 20482849, 20484027, 20505342, 20531297, 20531310, 2054780, 20556506, 20617168, 20625127, 20665103, 20682066, 20729390, 20809360, 20813970, 20814819, 20818337, 20859678, 20878674, 20889718, 20920981, 20953833, 20959472, 20959477, 20960227, 20966540, 20978202, 20978357, 20980149, 21041379, 21084273, 21084382, 21088384, 21102415, 21118977, 21122099, 21124932, 21138954, 21139866, 21153724, 21168302, 21172025, 21184269, 21209903, 21220595, 21245318, 21264507, 21276249, 21278442, 21281480, 21282336, 21306611, 21325071, 21356353, 21363912, 21375733, 21415164, 21421518, 21447808, 21458421, 21472434, 21482677, 21496870, 21498706, 21511357, 21523713, 21543766, 21571868, 21573489, 21617856, 21630023, 21643691, 21695196, 21700719, 21706157, 21721934, 21735116, 21750200, 21755340, 21769435, 21784954, 21792626, 21796367, 21825015, 21831037, 21847643, 21852249, 21858162, 21877141, 21901488, 21912605, 21920623, 21939527, 21947652, 21947828, 21977969, 21986093, 22025313, 22025563, 22037828, 22042793, 22049059, 22079037, 2208151, 22086303, 22086908, 22087758, 22105146, 22112467, 22119744, 22138580, 22139444, 22151997, 22157294, 22231421, 22240506, 22261811, 22266866, 22301780, 22308418, 2230896, 22320227, 22351618, 22362381, 22374518, 22391567, 22417858, 22426945, 22442308, 22460789, 22461340, 22462654, 22480149, 22496456, 22508827, 22511931, 22530051, 22531679, 22551578, 22559056, 22559974, 22585698, 22626971, 22648732, 22699783, 22720981, 22723919, 22751110, 22752292, 22785207, 22787161, 22807578, 22809143, 22812573, 22820289, 22847191, 22868912, 22875649, 22892847, 22898337, 22922440, 22929540, 22965832, 22986741, 2302226, 23024189, 23035882, 23042559, 23063783, 23068099, 23098526, 23100016, 23104890, 2311069, 23127292, 23131391, 23133541, 23143558, 23169272, 23172894, 23175448, 23184080, 23186136, 23216744, 23220842, 23292282, 23325583, 2332903, 23330677, 23340303, 23342133, 23348384, 2335395, 23391338, 23420063, 23447578, 23467929, 23468243, 23486015, 23523357, 23533663, 23540573, 23542418, 2354445, 23548208, 23559098, 23606532, 23609471, 23626833, 23629941, 2364377, 23663520, 23675755, 23677930, 23679233, 23695389, 23704974, 23717438, 23743933, 23757354, 23765060, 23771733, 23787040, 23810005, 23810988, 23832257, 23832543, 23832664, 23861345, 23873111, 23874775, 23900261, 23912957, 23913383, 23923010, 23928990, 23933801, 23939688, 23967302, 23973262, 23977306, 23991063, 23996684, 24013225, 24031087, 24036662, 24058649, 24070170, 24072219, 24092810, 24122391, 24156016, 24166501, 24166930, 24201803, 24223121, 24252436, 24258260, 24317156, 24333596, 24335662, 24337596, 24337703, 24343304, 24344012, 24351403, 24368280, 24368439, 24377825, 24388359, 24410765, 24413532, 24440656, 24443386, 24462521, 24463007, 24465590, 24485087, 24488617, 24495356, 24509169, 24511005, 24515104, 24525232, 24552459, 2459605, 24596201, 24599585, 24604205, 24622770, 24637461, 24637950, 24667650, 24670917, 24692081, 24705462, 24721635, 24735615, 24755315, 24758297, 24780616, 24843314, 24846828, 24853384, 24884830, 24887359, 24916694, 24938375, 24947930, 24954507, 24970479, 24997853, 25005139, 25042571, 25047471, 25053278, 25070479, 25099679, 25100862, 25117069, 25120063, 25123132, 25168343, 25218234, 25219498, 25231886, 25236687, 25240289, 25255861, 25269750, 25281718, 25288324, 25307233, 25310221, 25326397, 25351113, 25351767, 2535880, 25377474, 25394563, 25409762, 25425972, 25436982, 25450861, 25480943, 25520392, 25529635, 25582774, 25583948, 25625755, 2563719, 25655427, 25657113, 25666264, 25674240, 25701109, 25725194, 25725373, 25740058, 25743846, 2576351, 25763854, 25816016, 25825714, 25848861, 25849327, 25852060, 25862786, 25864647, 25875093, 25877889, 25880075, 25884832, 25904752, 25919761, 25924995, 25927974, 25932962, 25970543, 25972244, 25979954, 25992689, 25994408, 25994573, 26011102, 26052094, 26057454, 26072275, 26122181, 26165763, 26171919, 26179105, 26180042, 26187699, 26215677, 26234940, 26251034, 26252518, 26260807, 26261103, 26271713, 26273195, 26276891, 26289382, 26297734, 26308378, 26317216, 26339626, 26346768, 26351264, 26385458, 26408687, 26416046, 26425077, 26436206, 26455641, 26468985, 26472348, 26485755, 26500237, 26503703, 26530297, 26531187, 26552431, 26554309, 26560360, 26628467, 26630576, 26645718, 26650177, 26686064, 26715507, 26721227, 26727311, 26749282, 26796959, 26826118, 26838218, 26856771, 26868122, 26876199, 26920143, 26957478, 2696563, 27001563, 27012497, 27018308, 27020862, 27029552, 2703268, 27059031, 27062369, 27064865, 27079770, 27094311, 27115465, 27121722, 27139182, 27141101, 27175587, 27176937, 27183356, 27185370, 27225751, 2725532, 27259327, 27269948, 27277684, 27357606, 27372070, 27386569, 27389553, 27431784, 27447970, 27458152, 27463363, 27484095, 27488105, 27491861, 27528028, 27533791, 27535130, 27542969, 27551012, 27572263, 27581495, 2761986, 27620280, 27666130, 27683176, 27694140, 27721408, 27737921, 27748765, 27749742, 27753535, 27753538, 27768589, 27805252, 27829232, 27834468, 27852327, 27872957, 27886589, 27888136, 27891654, 27974701, 27988896, 27998656, 28030809, 28039357, 28045625, 28052940, 28055379, 28062545, 28062672, 28064383, 28087608, 28099174, 28100469, 28108518, 28122895, 28131743, 28139036, 28145091, 28148288, 28153508, 28161190, 28163101, 28173783, 28216224, 28243121, 28245550, 28245776, 28260926, 28263391, 28263985, 28266967, 28276034, 28280221, 28283546, 28301080, 28324268, 28371729, 28374222, 28378571, 28388952, 28389994, 28391512, 28415602, 28416634, 28416776, 28425758, 28430646, 28433540, 28443466, 28445992, 28450698, 28466123, 28467815, 28476021, 28476032, 28480663, 28487351, 28487444, 28489509, 28493933, 28522562, 28533055, 28534357, 28534358, 28565832, 28579181, 28586788, 28589742, 28601383, 28604461, 28607590, 28632792, 28647387, 28661760, 28672102, 28678022, 28689363, 28690649, 28690652, 28701017, 28704324, 28704710, 28705918, 28714517, 28724435, 28730256, 28744792, 28751448, 28765906, 28778025, 28791684, 28795252, 28801307, 28814897, 28815327, 28816969, 28825136, 28830573, 28843709, 28854070, 28856074, 28864454, 28874120, 28882624, 28885360, 28903991, 28912144, 28915659, 28934092, 28937296, 28942309, 28945887, 28957821, 28972041, 28975433, 28975625, 29029640, 29033607, 29051317, 29062076, 29070044, 29089281, 29096893, 29110152, 29113424, 29123100, 29132556, 29132565, 29133279, 29134565, 29135104, 29135722, 29137314, 29144542, 29147603, 29148091, 29164974, 29166868, 29176513, 29178258, 29181007, 29186712, 29187405, 29187427, 29196616, 29198300, 29207959, 29212167, 29219225, 29229933, 29234247, 29237913, 29241890, 29249638, 29250651, 29254147, 29261144, 29275864, 29281999, 29349448, 29351904, 29357906, 29361175, 29409530, 29416786, 29422258, 29424451, 29434831, 29434968, 29444929, 29454903, 29465508, 29471794, 29474646, 29478216, 29543921, 29554469, 29555554, 29559561, 29563191, 29573619, 29573739, 29575937, 29587674, 29599348, 29615433, 29644882, 29659014, 29673111, 29680193, 29684420, 29693354, 29700408, 29700710, 29714680, 29736566, 29738697, 29741562, 29763465, 29763858, 29805613, 29807696, 29848724, 29881297, 29898762, 29904427, 29931120, 29941485, 29945816, 29973689, 29979736, 29987610, 30007957, 30031954, 30038216, 30046001, 30053901, 30072192, 30093965, 30115027, 30121621, 30132794, 30139383, 30151737, 30166604, 30179299, 30188375, 30194175, 30200791, 30221739, 30229826, 30230580, 30250578, 30259332, 30278574, 30279965, 30289978, 30324492, 30324661, 30343278, 30346835, 30355675, 30358192, 30373552, 30375428, 30377566, 30412123, 30416390, 30423170, 30424783, 30430768, 30450159, 30498371, 30509870, 30524378, 30546463, 30555413, 30563991, 30572845, 3058236, 30585764, 30587150, 30591548, 30598260, 30610490, 30631046, 30636932, 30655946, 30664189, 30675282, 30692633, 30702971, 30718355, 30731397, 30737670, 30741415, 30742607, 30782165, 30793198, 30795773, 30806788, 30856373, 30859501, 30877098, 30915662, 30916428, 30953488, 30963401, 30987380, 30987772, 30993643, 30995175, 31010819, 31028192, 31035019, 31046118, 31062358, 31066241, 31077689, 31098866, 31110002, 31143231, 31151151, 31152137, 31180176, 31209809, 31212042, 31213902, 31219817, 31233192, 31240590, 31248446, 31261650, 31276668, 31281728, 31281731, 31289559, 31307414, 31315058, 31318440, 31323949, 31328463, 31332233, 31336602, 31338656, 31372841, 31391089, 31391850, 31404155, 31415823, 31422497, 31430979, 31440208, 31452692, 31515643, 31519397, 31523581, 31524275, 31531802, 31551181, 31552220, 31576238, 31588183, 31595691, 31598343, 31606975, 31611744, 31618131, 31620243, 31652293, 31669227, 31675993, 31689877, 31689915, 31721572, 31763993, 31783577, 31804368, 31817155, 31838731, 31844921, 3321071, 3677099, 3818154, 6288225, 6378283, 7272941, 7496840, 7501116, 7615356, 7664983, 7672698, 7705708, 7743517, 7775635, 7841539, 7851874, 7861463, 7865848, 7885545, 7903907, 7905302, 7914825, 7927940, 7932810, 7981453, 8018376, 8043496, 8063776, 8105035, 8133533, 8156519, 8240704, 8252481, 8261407, 8358738, 8379528, 8406198, 8440747, 8443399, 8443766, 8491760, 8496982, 8519686, 8595412, 8609661, 8625078, 8722747, 8744803, 8781700, 8814449, 8838865, 8880875, 8910626, 8919544, 8973592, 9009243, 9010317, 9056208, 9065812, 9103405, 9130685, 9131589, 9137083, 9137105, 9143583, 9143843, 9195227, 9221812, 9223327, 9241077, 9247911, 9259397, 9266239, 9331099, 9367686, 9466655, 9492061, 9510472, 9523727, 9537227, 9570831, 9605408, 9635570, 9662379, 9669814, 9706140, 9747868, 9771923, 9780024, 9790916, 9815968, 9815973, 9850067, 9858771		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	7736403		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	27989899		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	16087727, 19173015, 20944147, 8630958		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	31187953		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	24114859, 35830136	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30930100		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12709435, 16524385, 19476546, 20080637, 23584859, 26122040, 26158518, 8475123, 9370219	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	19476546, 20080637, 23271418, 24121066, 26158518, 28214999, 28882441, 29932870, 7903862, 8475123, 8732681, 9169520, 9328204, 9892851		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	CTD_human_DG	27366082		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	35850708	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36229517	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	19061285		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	21075781		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	27289045		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	24114859, 29077516		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	25876993		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	26554525		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27879963, 28266626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	29498920		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15331175, 15735050, 15986439, 16033821, 18949413, 19706809, 20729390, 21262360, 21524465, 21600232, 22169480, 22985911, 23677568, 24174373, 25085583, 25310221, 26456481, 26678909, 27234503, 27501049, 27572263, 28445992, 28877783, 29328407, 29454903, 29758295, 31322541, 31395685		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	16267616, 31077012		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28760353		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	14555521		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10690532, 11092983, 11342981, 11782368, 11929326, 15217497, 19657752, 19700746, 20179229, 21092257, 21375733, 21756866, 22252842, 23752191, 24596378, 24634376, 25770732, 26384318, 26768485, 26884359, 27780311, 27837296, 27943525, 28084333, 28178722, 28371110, 28595965, 28766214, 29491049, 29559742, 29946862, 29955142, 30190195, 30338425, 30383678, 30403906, 31120565, 31192864, 31240590, 31337506, 31357602, 31786415		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11275948, 17016614, 17224934, 17509633, 17513703, 18053221, 19375130, 19960008, 20140702, 21750966, 23891823, 24140101, 24957076, 25468909, 25476497, 25583948, 25823469, 26817629, 27522322, 28052940, 28373182, 28502695, 28627236, 28708432, 28912152, 29097993, 29187227, 29234306, 29357906, 29474646, 29740325, 29947997, 30046001, 30287090, 30387004, 30520976, 30620711, 30831189, 30851382, 30862719, 30944014, 30974146, 31002529, 31220580, 31403177, 31745566		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	19375130, 19491387, 19960008, 21191117, 23300848, 23741969, 24266697, 24558408, 25476497, 28199328, 30255696, 30862719, 31362937, 35682668, 36139419, 36297109	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	20667977		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	25283589, 28052940, 34304004	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	25823469, 25884832, 29546532	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	18053221, 19491387		★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	20850223		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	20850223		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	18445777	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	30479097	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	10379895, 10572247, 10913246, 11159857, 11331294, 11398888, 11517301, 11899120, 11968000, 12351689, 12874002, 14637391, 14718791, 1491696, 14981945, 14988466, 15015704, 15182430, 15183535, 15355892, 15358790, 1556769, 15589576, 15608675, 15701882, 15806142, 15860267, 16103452, 16107734, 16232348, 16475975, 16505096, 16608533, 16609019, 16645950, 16682955, 16723304, 16737553, 16738884, 16949628, 16954437, 17130524, 17140257, 17158758, 17453334, 17520659, 17683518, 17726259, 17850661, 17882159, 17942301, 17973251, 17975144, 18056454, 18059023, 18245484, 18258979, 18340528, 18483465, 18631401, 18712725, 18768663, 18794137, 18820009, 18821012, 18821585, 19047159, 19061505, 19148464, 19244106, 19270750, 19350539, 19366795, 19380452, 19421167, 19435893, 19455332, 19491898, 19522736, 19546354, 19567422, 19569049, 19609946, 19619298, 19671800, 20065188, 20110775, 20130982, 20133251, 20149218, 20154269, 20213082, 20332324, 20370918, 20530877, 20535543, 20569502, 20569503, 20571172, 20697068, 20705611, 20720010, 20803240, 21084382, 21129090, 21170268, 21269472, 21273576, 21298336, 21304180, 21346144, 21362200, 21389059, 21420991, 21421116, 21430657, 21431343, 21537874, 21613801, 21658239, 21738574, 21771784, 21784954, 21835891, 21863258, 21900890, 21947652, 21947828, 21984694, 22015292, 22114931, 22156833, 22174013, 22216287, 22240506, 22267197, 22286763, 22313737, 22331459, 22351618, 22551578, 22577344, 22618231, 22706628, 22785207, 22792175, 22963717, 22971289, 22976474, 23054611, 23143756, 23213055, 23301057, 23342080, 23347430, 23382923, 23395885, 23467929, 23493347, 23518928, 23535733, 23538857, 23546601, 23554355, 23593250, 23643682, 23696246, 23717438, 23758962, 23814023, 23817433, 23839043, 23844228, 23911789, 23982878, 24060333, 24118529, 24128438, 24160266, 24239807, 24244489, 24253811, 24280132, 24366551, 24391143, 24398047, 24472707, 24475282, 24481452, 24520381, 24549642, 24552459, 24618835, 24659641, 24669750, 24670685, 24698107, 24836190, 24929677, 24957076, 24970679, 24973581, 24975086, 25003827, 25158023, 25211228, 25240289, 25275589, 25373603, 25447904, 25488809, 25491778, 25522763, 25531331, 25535979, 25622979, 25640367, 25644501, 25667100, 25672508, 25679392, 25732226, 25756514, 25782411, 25789479, 25857231, 25876993, 25881544, 25892968, 25917453, 25923108, 25928008, 25929338, 25964295, 25999793, 26026468, 26052034, 26113056, 26124144, 26208486, 26219409, 26320033, 26350565, 26356672, 26456572, 26490514, 26529585, 26549026, 26560360, 26563373, 26569340, 26585578, 26657294, 26661278, 26681738, 26733612, 26850467, 26877254, 26927093, 27063095, 27083183, 27102299, 27147578, 27191888, 27246191, 27270325, 27342400, 27353038, 27357940, 27380242, 27427852, 27448983, 27472462, 27485598, 27491861, 27508402, 27548161, 27551012, 27593929, 27609189, 27823907, 27852327, 27853906, 27879270, 27959398, 27964748, 27995352, 27997592, 28122895, 28147342, 28160860, 28173834, 28186980, 28192639, 28209156, 28211214, 28245550, 28270510, 28276460, 28332571, 28336670, 28374222, 28374324, 28399921, 28415819, 28418845, 28457968, 28488912, 28490933, 28493933, 28529550, 28565832, 28582508, 28624455, 28637868, 28643022, 28643023, 28669345, 28669712, 28739487, 28743680, 28748445, 28766132, 28784863, 28795252, 28798032, 28810913, 28845597, 28856074, 28877935, 28878133, 28881721, 28910567, 28912152, 28939591, 28956736, 28968647, 28979817, 28982874, 28985022, 28985473, 29028222, 29050219, 29052968, 29086897, 29087485, 29088778, 29116467, 29117498, 29127189, 29128898, 29130361, 29141657, 29141994, 29162888, 29180066, 29181633, 29202405, 29219225, 29222346, 29229606, 29236174, 29236235, 29241203, 29247596, 29257261, 29284425, 29289555, 29289986, 29325144, 29337187, 29357201, 29378048, 29423076, 29423105, 29436393, 29445914, 29450494, 29453409, 29466767, 29471853, 29482551, 29482944, 29485433, 29507656, 29507672, 29524408, 29545966, 29567811, 29587753, 29626519, 29644867, 29663173, 29664714, 29707142, 29720121, 29733910, 29792859, 29804490, 29804556, 29905023, 29921289, 29925919, 29934327, 29934505, 29959421, 29965974, 29970508, 29975948, 30007957, 30022044, 30038670, 30038716, 30050469, 30066905, 30080878, 30089255, 30093354, 30097312, 30119678, 30143015, 30149225, 30153552, 30154367, 30158597, 30161001, 30179299, 30191958, 30196425, 30233207, 30259117, 30262900, 30275856, 30278072, 30290832, 30301939, 30314968, 30315845, 30328006, 30368741, 30387028, 30389903, 30404658, 30405412, 30411242, 30417652, 30431262, 30465157, 30497079, 30498869, 30534999, 30536017, 30542717, 30573685, 30573731, 30614786, 30621641, 30640711, 30648747, 30658268, 30675242, 30700309, 30741415, 30747221, 30759864, 30806044, 30811755, 30813337, 30851382, 30878502, 30881995, 30883634, 30897853, 30920079, 30941654, 30967597, 30967627, 30990042, 31002529, 31002890, 31046118, 31048002, 31059536, 31118607, 31124293, 31142157, 31151151, 31165373, 31171849, 31180176, 31221824, 31233192, 31280452, 31318440, 31331091, 31337657, 31340854, 31393200, 31393518, 31403177, 31406251, 31423189, 31423426, 31439579, 31448056, 31471681, 31479913, 31501276, 31504407, 31506496, 31518875, 31519767, 31534012, 31552220, 31559573, 31563769, 31576449, 31590917, 31598343, 31614463, 31647985, 31663114, 3167228, 31675993, 31689948, 31727690, 31733575, 31739520, 31742207, 31760402, 31762828, 31796030, 31812165, 31819634, 31821370, 31826233, 31839155, 31845230, 7850813, 7851874, 8219254, 8284222, 8669823, 8764133, 9242379, 9632722, 9731700, 9837972		★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	12114294		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	CTD_human_DG	20833731		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic atrophy	Pubtator	37946484	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	30760894		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	31594912		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	30715409, 31228270		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	30715409, 32188745, 34304004	Associate	★☆☆☆☆ Found in Text Mining only
OSSIFICATION OF THE POSTERIOR LONGITUDINAL LIGAMENT OF SPINE	Ossification Of The Posterior Longitudinal Ligament Of Spine	BEFREE	12195069		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	14997007, 21959292, 29082243		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12847685, 15380041, 16815861, 20131243, 20417295, 24772413, 33021861, 36262248, 39189559	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	17419075, 20417295	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	12847685, 15380041, 16453284, 20417295, 24772413	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	17419075		★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	LHGDN	17419075		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	15380041, 24772413		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteopenia	Osteopenia	BEFREE	10678404, 10703934, 10773580, 10806217, 11092403, 11730247, 11886765, 12014437, 15070949, 15744038, 15827868, 16735942, 17896124, 21423915, 23073829, 24023068, 26049585, 26634548, 27974229, 28768649, 29259034, 29422346, 29794404, 29869503, 30066871, 31479513, 9275080		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	CTD_human_DG	18505767		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	10323246, 10782923, 10914844, 10942433, 11149476, 11716992, 11846326, 11874716, 12183765, 12562211, 12961063, 15237001, 15258723, 15324358, 15523071, 15621207, 15692074, 15744038, 16530497, 16972020, 17889406, 17896124, 17953702, 19151030, 19255718, 19506792, 20357503, 20508921, 20554715, 21423915, 21646926, 21734414, 21920358, 22311020, 23137636, 23682072, 23731710, 24023068, 24430505, 24481452, 24481879, 24881676, 25148458, 27119523, 27323138, 27522465, 27974229, 28161223, 28238769, 28711499, 28768651, 28858267, 28884379, 29030155, 29443456, 29458346, 29777335, 29901636, 30113650, 30144296, 30241506, 30556843, 30601066, 31343176, 31450614, 31518568, 8526937, 9506753, 9556070		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	11149476, 15231017, 15237001, 17324916, 17889406, 18433299, 19386104, 19729795, 20357503, 22328322, 23300848, 23731710, 23915851, 24598415, 24997336, 25152917, 26930606, 27323138, 30241506, 30556843, 30569177, 32493284, 33021861, 35069454, 35511874, 35718863, 38098042, 39694404, 39953608, 40660573	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	LHGDN	12183765, 17324916, 17953702, 18433299, 18942332		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	10703934, 11846326, 15237001, 15647972, 15744038, 16530497, 18433299, 19903038, 26001094, 26676054, 27323138, 29151553, 29458346, 30569177, 31091133, 31406012, 8852941		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	LHGDN	14764789		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11856647, 14528100, 15033914, 15090226, 20420908, 25592968, 27127126, 27272849, 28259906, 28849169, 29644882, 30182951, 30341688, 30385323, 30593524, 30790283, 30873755, 30877098, 3164526, 7639112, 7976507, 8033827		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	15802376		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28259906, 34681897, 35876436	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	12782587, 19675076, 21102415, 23390495, 24908329, 31495455		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Cysts	Ovarian cysts	Pubtator	10856486, 11384649, 22495744	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	BEFREE	30866655, 9262271, 9850067		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	10856486, 17454161, 18550773, 19001520, 19487548, 21207255, 21269613, 22749220, 22977660, 23006437, 23749764, 30728052, 36401248, 37033258	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	29629944	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	10331614, 17706202, 19861327, 20095908, 20797716, 23116284, 23150099, 23805834, 24103315, 25428437, 29112712, 30156935		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	LHGDN	17706202		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	25526766	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10720062, 11489814, 11870520, 14648706, 16176503, 17535880, 18165403, 18690166, 19749010, 20056644, 22351618, 23095717, 23402742, 23580092, 24171864, 24376209, 24410765, 24466274, 24481591, 24604205, 26797759, 26871282, 28073843, 28264438, 28376175, 28859612, 29137401, 29196616, 29250651, 29807696, 29885789, 30302736, 31077012, 8541224, 8878453, 9252329, 9605408, 9655254		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12969589		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10318951	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10960636, 11384649, 14534882, 15679420, 16773633, 17575226, 18187487, 18550773, 18690166, 18854640, 19054566, 19079715, 19238079, 19331143, 19383883, 19487548, 20056644, 21102415, 21207255, 22249577, 22549810, 22978347, 23095717, 23176303, 23284037, 23368871, 23438850, 23706170, 23841731, 23962610, 24171864, 24376209, 24674832, 24908329, 25476534, 25616260, 26871282, 26972162, 27230211, 27458161, 27689466, 27720231, 27754803, 28225892, 28264438, 28416763, 28859612, 29157627, 29187928, 30051594, 30302736, 30597961, 32192517, 32856599, 33004058, 33723801, 33817715, 33891016, 34207568, 34215221, 34672090, 35735430, 36430718, 36867576, 37684671, 37874327, 38000680, 8878453, 8986764	Associate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	8530610		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	25408199, 25655200, 29341930		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	14997007, 29082243		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19020750, 30373552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30373552		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	18714175		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29115476, 32513126	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21707866, 22936184, 24884830, 25423566, 25594859, 25862786, 28124274, 28882636, 28947799, 29128169, 29368272, 29655286, 30538565, 30705367, 31509841, 31718595		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	24858917	Stimulate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	31096567		★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	36828304	Associate	★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	23497414	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	23024189		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	23024189		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10362895, 12112198, 12174171, 16182609, 18980828, 20304699, 24171864, 24595449, 27796870, 29649433, 30974833		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	20304699, 24171864	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	30611552, 36401248	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	22038234, 24721264, 29241914, 31270553		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	22038234, 29241914, 37430099	Associate	★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	16553027, 18375409, 19864317, 20215396, 23088992, 25463985, 31520742		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	11016622		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31504982		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	15324358, 21163127, 26688601, 31411781		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	29526366		★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	30689838		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	34234737	Associate	★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	21570196		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	11206334, 16554735, 27056456		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	21632819, 28043824		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30866655, 8090165		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	15103224		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	26908832, 27325254		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	12466349, 14505758, 16580389, 19185861, 20826587, 24171864, 25603724, 25617525, 28938480, 29535146, 30103849, 30745857, 31606536		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	16580389, 22296324, 24171864, 33622336, 35270805, 35830453, 36401248, 37047828, 38281964	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21269226, 25603724	Inhibit	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	25709077, 29250928, 30470649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precocious Puberty	Precocious puberty	LHGDN	16252695		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	23559367, 23585209, 26036718		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	10331614, 17706202, 19861327, 20095908, 20797716, 23116284, 23150099, 23805834, 24103315, 25428437, 29112712, 30156935		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	10362895, 10765041, 12174171, 15263903, 18072983, 20616674, 23491264, 23567436, 28789972, 28843780		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	17192785		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12169981, 26608979		★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	23917948, 27108164		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	17222350, 19252821, 20700755, 20797424, 21270509, 21422801, 27682355, 29335066, 30400032, 8733768		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	19383985, 24053619, 28627585	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10440698, 10676656, 10960840, 11096250, 11179905, 11244506, 11280747, 11536308, 11595700, 11752866, 11782371, 11855735, 11948106, 12122114, 12152165, 12606125, 12891629, 14499686, 14508827, 14755680, 15161636, 15358197, 16099479, 16406987, 16551880, 17176215, 17525739, 17598908, 17606710, 17649823, 17879940, 17908481, 18006911, 18952763, 19126643, 19189301, 19250214, 19505920, 19654868, 19904497, 19952760, 20184087, 20615892, 21106711, 22228197, 22248281, 22403175, 22508765, 22549291, 22593181, 23028063, 23098495, 23135751, 23186779, 23737135, 23805288, 24171864, 24374826, 24414486, 24584714, 24859835, 25080090, 25369892, 25409762, 25415230, 25436982, 25828708, 25931004, 26010887, 26124144, 26251204, 26547439, 26575018, 26803986, 27259327, 27696457, 27776343, 28115406, 28147335, 28353585, 28667081, 28721070, 29094395, 29249638, 29254246, 29360794, 29455003, 29654831, 29662238, 29984337, 30555629, 30904591, 30918758, 31054895, 31108117, 31125586, 31234546, 7501542, 8722747, 9266239		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Diseases	Prostatic disease	Pubtator	10433957	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	17640960		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	23792768, 28261681, 28353585, 31094703, 39806744	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	33031138	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	10433957, 31054895	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	CTD_human_DG	16220300		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10433957, 12122114, 15330195, 16207477, 17486135, 18505969, 19041175, 19654868, 21106711, 21694441, 22403175, 22508765, 22549291, 23135751, 23169992, 23744763, 24171864, 24555436, 25080090, 25219910, 25415230, 25535400, 26251204, 26572708, 27610593, 27922078, 28147335, 28353585, 28981526, 29249638, 29495557, 30361641, 31054895, 32132580, 32328032, 33503805, 34864989, 35292057, 36376959, 37176106	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11280747, 12180238		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12891629, 15358197, 16756716, 18483761, 18952763, 19107851		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16220300, 17176215		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	29121167		★☆☆☆☆ Found in Text Mining only
Protoplasmic astrocytoma	Protoplasmic Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27035208, 29656791		★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychiatric disorders	Pubtator	23932494	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20081107	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29886191		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31291549		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	29292666		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	19847432, 26546109, 28968703, 29652660, 30729371		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12207901, 12770739, 15867365, 19207611, 23460808, 25351113, 27107064, 30171816, 30271170		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12207901, 12770739		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29021537		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	23459444, 29112114		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	17356055, 18037365, 18577416, 19234134, 21367843, 21756866, 22811582, 23900261, 29483206, 29963233		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	18568888		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	40084286	Associate	★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	22418568		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	12495475	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	18451176		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10914844, 11930657, 12114259, 15588074, 15899029, 16060666, 19847432, 21174621, 21762042, 24089231, 24861435, 26546109, 27028940, 27522465, 27722902, 27749227, 28285975, 28321492, 28569211, 28583648, 28850019, 28968703, 29144542, 29315763, 29382374, 29589156, 29652660, 29656791, 29679167, 29798702, 29901636, 30048859, 30123796, 30130534, 30376345, 30590784, 30729371, 30832414, 31295280, 31316517, 31435754, 31600634, 31772500, 31823143		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	15361203	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	14516317, 14528100, 21700719		★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	15309019, 25991737	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	39349354	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	32076017, 39519004, 40660573	Associate	★☆☆☆☆ Found in Text Mining only
SCAPULOPERONEAL MYOPATHY, X-LINKED DOMINANT	Scapuloperoneal Myopathy, X-Linked	BEFREE	30861567		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11525424, 12566932, 18424448, 19386276, 19439407, 20801219, 22001950, 23497414, 27546373, 27842943, 29395611, 29670547, 30299258		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18424448		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19386276, 19439407, 20801219, 22001950, 23497414		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23497414, 28617822, 31906708	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	29292666, 30122544		★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	24155906, 25410117, 34064195, 35627124	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	34944396	Inhibit	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	17023856		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	LHGDN	17023856		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	22245602		★☆☆☆☆ Found in Text Mining only
Serous cystadenocarcinoma ovary	Ovarian Serous Cystadenocarcinoma	BEFREE	9506768		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	28373583		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	21804148		★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	12172107		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	19386276		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	PSYGENET_DG	19386276		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	15738791, 29465367		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	22986510, 24205108	Stimulate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	32493230	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27884793		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	29198300		★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	31261650	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	9421477	Associate	★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	27651465		★☆☆☆☆ Found in Text Mining only
Specific Language Disorder	Specific language disorder	Pubtator	17392432	Associate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	31208465		★☆☆☆☆ Found in Text Mining only
Spondylocostal dysostosis autosomal recessive	Spondylocostal dysostosis	Pubtator	22807154	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	11400122, 11781824, 16477637, 16582598, 16886637, 17904846, 18094411, 18814026, 19700746, 20109227, 21212030, 21922275, 22706629, 24464625, 24833090, 26425077, 28109853, 30881493, 9221812		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10935492, 17355262, 18949413, 20581058, 27688241		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22463081, 24101172, 27595756, 28724213		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19825947, 21781458, 26122040, 27475696, 30715409, 31696459, 32144339, 32452220, 32546279, 34304004, 38279245	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31611744		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21205741, 26122040, 28166815		★☆☆☆☆ Found in Text Mining only
Status Migrainosus	Status Migrainosus	CTD_human_DG	15133719		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28220039, 28760353, 29615085, 31062612, 31085239, 31168625		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12679906, 14767512, 20087349, 20339947, 20514458, 22093877, 23843035, 23918832, 27459504, 28983626, 29090670, 29210057, 29805694, 31452712, 31454993		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12439914, 12679906, 20087349, 20514458, 22961301, 23199240, 25534230, 27893427, 28388558, 31888440, 35107497, 37224786	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14767512		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	31594912		★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	28744158, 30340617		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	23763623, 26422690	Associate	★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	CTD_human_DG	24680642		★☆☆☆☆ Found in Text Mining only
Subfertility, Female	Subfertility	CTD_human_DG	23710174		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	15738791		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	15738791		★☆☆☆☆ Found in Text Mining only
Syringomyelia	Syringomyelia	BEFREE	29675990		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19032828, 29292666, 30122544		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Takayasu Arteritis	Takayasu Arteritis	BEFREE	28701681		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15679420		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	32947957	Associate	★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	19411060, 20656393, 21536254, 27519661, 29103441, 29175417, 29621430, 31646926		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	30537990		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	14555521		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	17711579	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	19776291		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	24171864	Associate	★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	22009847	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	17895504, 26014094		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	24823458	Associate	★☆☆☆☆ Found in Text Mining only
Thymus Hyperplasia	Thymus Hyperplasia	BEFREE	15661863		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	20372779, 21707866, 21947652, 24114184, 24884830, 25423566, 29655286, 30705367, 33592140, 35162942	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21142662, 27064865, 31790688		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	9448099	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	23106428		★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid hormone resistance	Pubtator	30560461	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17951536		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21142662, 21707866, 22531679, 27064865, 31790688, 9768687		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	20067378, 20372779, 24114184, 25576212, 26261608, 37955011, 38082224	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	20067378	Associate	★☆☆☆☆ Found in Text Mining only
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	25281718, 31248446		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	20798217, 21939527, 22362381, 25277734		★☆☆☆☆ Found in Text Mining only
Triglyceride storage disease with ichthyosis	Triglyceride Storage Disease With Ichthyosis	BEFREE	21059658		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	17387718, 18947390, 21721934, 21830158, 22006997, 23039971, 23555923, 24026994, 24642040, 25104201, 25208879, 25453096, 25961742, 26752006, 27129866, 30335837, 33057161, 34609409, 35603379, 37208678	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	18398030, 21264507, 21394499, 21840613, 21844186, 22362381, 23279980, 24325915, 24721635, 24833090, 26163605, 26280679, 27551012, 27859250, 28570501, 30115973, 30613307, 31311992, 31395590, 31519689, 32358373, 32424219, 33302456, 33355355, 35294224, 35780210, 35846880, 36008466, 36157217, 36674737, 38049758, 39193850	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	18950515, 18981002, 19025652, 20664514, 20839950, 20861225, 20935677, 21161370, 21394499, 21421115, 21442356, 21717460, 21826373, 21844186, 22006997, 22010008, 22198466, 22263793, 22290080, 22323552, 22446188, 22524805, 22538770, 22662240, 22930220, 22976474, 23012297, 23116406, 23171949, 23172894, 23242585, 23307470, 23340303, 23373898, 23400579, 23456737, 23555923, 23637992, 23696021, 23842642, 23979844, 24020991, 24058584, 24126575, 24130769, 24188694, 24236784, 24282978, 24324816, 24346128, 24366407, 24431073, 24477977, 24510657, 24634415, 24642040, 24786829, 24866769, 24874276, 24882351, 24884785, 24982892, 25212833, 25288324, 25310144, 25344583, 25347741, 25394563, 25420519, 25453096, 25503779, 25527230, 25566982, 25571912, 25590583, 25611337, 25638395, 25687182, 25748387, 25776849, 25883093, 25928379, 26009308, 26010302, 26045046, 26074263, 26088362, 26115764, 26201402, 26280679, 26341644, 26363006, 26431674, 26443806, 26455641, 26458489, 26686064, 26781859, 26826118, 26907936, 26921331, 26950360, 27045680, 27137755, 27186677, 27260947, 27393618, 27487152, 27663569, 27692773, 27737796, 27765921, 27775705, 27779689, 27848152, 27859250, 27902967, 27979916, 27994514, 28036267, 28069384, 28153508, 28189497, 28248089, 28253390, 28319069, 28388298, 28415749, 28421181, 28422142, 28423644, 28430626, 28435291, 28467815, 28521427, 28529129, 28529458, 28570501, 28576130, 28618929, 28647387, 28693277, 28696357, 28717401, 28734944, 28751463, 28849241, 28870998, 28886127, 28961506, 28961844, 28986287, 29042792, 29059676, 29069872, 29087320, 29100336, 29101636, 29115931, 29134467, 29137021, 29228315, 29228549, 29250179, 29261141, 29261144, 29281678, 29320459, 29323875, 29330856, 29392539, 29393238, 29393914, 29456719, 29522266, 29547591, 29552303, 29587339, 29633513, 29644001, 29662198, 29744674, 29902579, 29921827, 29978332, 30042152, 30050079, 30053090, 30100993, 30115973, 30125583, 30138940, 30165555, 30180881, 30186165, 30203490, 30223270, 30227653, 30247761, 30255019, 30289981, 30293712, 30321299, 30321870, 30323891, 30335837, 30338035, 30346453, 30363988, 30371505, 30388728, 30416486, 30419345, 30450577, 30555632, 30558648, 30563138, 30583472, 30607633, 30628707, 30642351, 30660004, 30691108, 30697064, 30707920, 30725384, 30791936, 30796353, 30826934, 30845378, 30867801, 30867840, 30873822, 30935371, 30964885, 31002359, 31003514, 31011629, 31075076, 31088482, 31093512, 31093668, 31155832, 31186742, 31190337, 31197620, 31207943, 31231612, 31233192, 31257479, 31261818, 31337024, 31342364, 31348739, 31414243, 31416135, 31456192, 31461380, 31519689, 31570423, 31590917, 31704972, 31707383, 31761352, 31786854, 31788105, 31816634, 31826233, 31839713		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	18374399	Associate	★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	21499302, 24684682, 26487496, 28209156, 30848213		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	20215533	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	31522348		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	21271267, 27651465, 27879963, 31671406		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	27651465	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16361578, 17372743, 20505342, 27488327, 31261736, 31435166, 31450614		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	15637090, 17173897		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	12605096, 15576061, 22051074, 22901010, 26169989, 28589742		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	15679420, 20383761	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16700038, 18310301, 37668795	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	29769420	Associate	★☆☆☆☆ Found in Text Mining only
Urogenital Abnormalities	Urogenital abnormalities	Pubtator	17982251	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	27635763	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28786878		★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	28704324		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19858087	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	40362654	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15185748, 15361203, 15983032, 17137618, 17971771, 18751393, 26056290, 26499945, 29229929, 29806603, 32368784, 32885893, 34784845, 38003540, 40446016, 40603406, 9741542	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23923078, 34151839	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	40362654	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	10835496, 19626649, 25144715, 27516013, 29760378, 35303800	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine Diseases	BEFREE	11139535, 8735603		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	10397250, 10574596, 11035987, 11232041, 11239543, 11297607, 11826769, 12065682, 12149410, 12524070, 12552233, 15474102, 15547533, 16357844, 16595228, 16603566, 16860797, 16935316, 17121748, 18166184, 18701604, 19012097, 19240151, 19729795, 21421902, 22377971, 22850687, 23749503, 24384850, 26529545, 27100507, 27454940, 27871850, 28203428, 29970676, 30390345, 30431607, 31468104, 7775635, 9253340, 9780024		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	CTD_human_DG	18701604		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	26910219, 38000680	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	BEFREE	8735603		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29570260		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	32096196	Stimulate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	20045626		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11744408, 28775043		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	23763623	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	16492615, 40088950	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	17540666		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32664164	Associate	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	23932494	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	15381239		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	Pubtator	35777015	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	15381239		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	19328202, 20944147	Associate	★☆☆☆☆ Found in Text Mining only
Xanthomatosis Cerebrotendinous	Xanthomatosis	Pubtator	39557107	Associate	★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	22519360		★☆☆☆☆ Found in Text Mining only