Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2098
Gene name	Esterase D
Gene symbol	ESD
Synonyms (NCBI Gene)	FGH
Chromosome	13
Chromosome location	13q14.2
Summary	This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a geneti

Show/Hide all (72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049564	hsa-miR-92a-3p	CLASH	23622248
MIRT045577	hsa-miR-149-5p	CLASH	23622248
MIRT043244	hsa-miR-324-5p	CLASH	23622248
MIRT041306	hsa-miR-193b-3p	CLASH	23622248
MIRT438236	hsa-miR-525-3p	Luciferase reporter assay	24147004
MIRT438236	hsa-miR-525-3p	Luciferase reporter assay	24147004
MIRT438236	hsa-miR-525-3p	Luciferase reporter assay	24147004
MIRT438236	hsa-miR-525-3p	Luciferase reporter assay	24147004
MIRT637108	hsa-miR-3942-5p	HITS-CLIP	23824327
MIRT637107	hsa-miR-4703-5p	HITS-CLIP	23824327
MIRT618713	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT618712	hsa-miR-3934-3p	HITS-CLIP	23824327
MIRT618707	hsa-miR-183-3p	HITS-CLIP	23824327
MIRT618706	hsa-miR-4452	HITS-CLIP	23824327
MIRT618705	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT618704	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT618703	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT618715	hsa-miR-33a-3p	HITS-CLIP	23824327
MIRT618714	hsa-miR-4307	HITS-CLIP	23824327
MIRT618713	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT618712	hsa-miR-3934-3p	HITS-CLIP	23824327
MIRT618711	hsa-miR-2052	HITS-CLIP	23824327
MIRT618710	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT618709	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT618708	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT618707	hsa-miR-183-3p	HITS-CLIP	23824327
MIRT618706	hsa-miR-4452	HITS-CLIP	23824327
MIRT618705	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT618704	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT618703	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT445438	hsa-miR-5571-5p	PAR-CLIP	22100165
MIRT445437	hsa-miR-589-5p	PAR-CLIP	22100165
MIRT445436	hsa-miR-146a-5p	PAR-CLIP	22100165
MIRT445435	hsa-miR-146b-5p	PAR-CLIP	22100165
MIRT445434	hsa-miR-7153-5p	PAR-CLIP	22100165
MIRT445433	hsa-miR-374c-5p	PAR-CLIP	22100165
MIRT445432	hsa-miR-655-3p	PAR-CLIP	22100165
MIRT445431	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445430	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT637108	hsa-miR-3942-5p	HITS-CLIP	23824327
MIRT637107	hsa-miR-4703-5p	HITS-CLIP	23824327
MIRT618713	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT618712	hsa-miR-3934-3p	HITS-CLIP	23824327
MIRT618707	hsa-miR-183-3p	HITS-CLIP	23824327
MIRT618706	hsa-miR-4452	HITS-CLIP	23824327
MIRT618705	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT618704	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT618703	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT618715	hsa-miR-33a-3p	HITS-CLIP	23824327
MIRT618714	hsa-miR-4307	HITS-CLIP	23824327
MIRT618713	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT618712	hsa-miR-3934-3p	HITS-CLIP	23824327
MIRT618711	hsa-miR-2052	HITS-CLIP	23824327
MIRT618710	hsa-miR-19a-5p	HITS-CLIP	23824327
MIRT618709	hsa-miR-19b-1-5p	HITS-CLIP	23824327
MIRT618708	hsa-miR-19b-2-5p	HITS-CLIP	23824327
MIRT618707	hsa-miR-183-3p	HITS-CLIP	23824327
MIRT618706	hsa-miR-4452	HITS-CLIP	23824327
MIRT618705	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT618704	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT618703	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT445438	hsa-miR-5571-5p	PAR-CLIP	22100165
MIRT445437	hsa-miR-589-5p	PAR-CLIP	22100165
MIRT445436	hsa-miR-146a-5p	PAR-CLIP	22100165
MIRT445435	hsa-miR-146b-5p	PAR-CLIP	22100165
MIRT445434	hsa-miR-7153-5p	PAR-CLIP	22100165
MIRT445433	hsa-miR-374c-5p	PAR-CLIP	22100165
MIRT445432	hsa-miR-655-3p	PAR-CLIP	22100165
MIRT445431	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445430	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT970209	hsa-miR-4257	CLIP-seq
MIRT970210	hsa-miR-4272	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IDA	19126594
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IEA
GO:0018738	Function	S-formylglutathione hydrolase activity	IBA
GO:0018738	Function	S-formylglutathione hydrolase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 31515488, 32296183
GO:0046294	Process	Formaldehyde catabolic process	IEA
GO:0047374	Function	Methylumbelliferyl-acetate deacetylase activity	IEA
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0052689	Function	Carboxylic ester hydrolase activity	NAS	3164702
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145

MIM	HGNC	e!Ensembl
133280	3465	ENSG00000139684

P10768

Protein name

S-formylglutathione hydrolase (FGH) (EC 3.1.2.12) (Esterase D) (Methylumbelliferyl-acetate deacetylase) (EC 3.1.1.56)

Protein function

Serine hydrolase involved in the detoxification of formaldehyde.

PDB

3FCX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00756	Esterase	23 → 275	Putative esterase	Domain

Sequence

MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQN
FISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRM
YSYVTEELPQLINANFPVDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVL
CPWGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFI
AACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLNA

Sequence length

282

Interactions

View interactions

	KEGG		Reactome
	Metabolic pathways Carbon metabolism		Glutathione conjugation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma, Tubular	Adenocarcinoma	BEFREE	30725253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28539229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	33491460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	686669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	21474795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28583071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31120926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	686669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	686669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	7835212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Retinoblastoma	Retinoblastoma	BEFREE	3164261, 3862370, 6731533, 6823558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	2838156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	2838156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	1679032, 2227943, 2563776, 30230192, 3163469, 3164702, 3189332, 3459695, 3462698, 3474893, 3856863, 8410043, 8432554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	2563776, 3189332, 3456572, 3462698, 3474893, 3856863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24085543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21474795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	2365372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	7553809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33531688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	2596526, 3164261, 6462624, 6823558, 6877367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16872493, 19543558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16355479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	2878716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	1679032, 19126594, 2227145, 2596526, 2630183, 2878716, 3032521, 3164261, 3164702, 3198126, 3346019, 3462698, 3471703, 3472646, 3502696 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	2876425, 3456572, 3462698, 3462714, 3462728, 3620311, 3813643, 6716423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	2878716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	2365372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Retinoblastoma	Retinoblastoma	BEFREE	6500578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31289600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	686669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	LHGDN	18552983		★★★★★ ★☆☆☆☆ Found in Text Mining only

ESD (esterase D)