AKT2 (AKT serine/threonine kinase 2)

Gene

• Entrez ID: 208
• Gene name: AKT serine/threonine kinase 2
• Gene symbol: AKT2
• Synonyms (NCBI Gene): HIHGHH, PKBB, PKBBETA, PRKBB, RAC-BETA
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains, which is involved in signaling pathways. The gene serves as an oncogene in the tumorigenesis of can

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434593	C>T	Pathogenic	Coding sequence variant, missense variant
rs387906659	C>A,T	Pathogenic	Stop gained, coding sequence variant, missense variant, 5 prime UTR variant
rs778561687	C>A,T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519754	T>C	Likely-pathogenic	Coding sequence variant, intron variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000425	hsa-miR-184	qRT-PCR, Luciferase reporter assay, Western blot	20409325
MIRT006104	hsa-miR-203a-3p	Northern blot, qRT-PCR, Western blot	21354697
MIRT006104	hsa-miR-203a-3p	Northern blot, qRT-PCR, Western blot	21354697
MIRT006473	hsa-miR-708-5p	PC3	22552290
MIRT006473	hsa-miR-708-5p	PC3	22552290
MIRT006473	hsa-miR-708-5p	PC3	22552290
MIRT006473	hsa-miR-708-5p	PC3	22552290
MIRT006104	hsa-miR-203a-3p	Northern blot, qRT-PCR, Western blot	21354697
MIRT006473	hsa-miR-708-5p	PC3	22552290
MIRT006473	hsa-miR-708-5p	PC3	22552290
MIRT006473	hsa-miR-708-5p	PC3	22552290
MIRT006473	hsa-miR-708-5p	PC3	22552290
MIRT022768	hsa-miR-124-3p	Microarray	18668037
MIRT031019	hsa-miR-21-5p	Western blot;Other	20048743
MIRT045569	hsa-miR-149-5p	CLASH	23622248
MIRT042572	hsa-miR-423-3p	CLASH	23622248
MIRT037571	hsa-miR-744-5p	CLASH	23622248
MIRT036895	hsa-miR-877-3p	CLASH	23622248
MIRT036081	hsa-miR-1296-5p	CLASH	23622248
MIRT053175	hsa-miR-612	Immunofluorescence, Luciferase reporter assay, Western blot	24704424
MIRT053175	hsa-miR-612	HCCLM3, HCCLM3-RFP, MHCC97H, HepG2, HepG2-GFP, SMMC-7721	23478189
MIRT054191	hsa-miR-29a-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	25428377
MIRT054191	hsa-miR-29a-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	25428377
MIRT054192	hsa-miR-29b-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	25428377
MIRT054192	hsa-miR-29b-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	25428377
MIRT054193	hsa-miR-29c-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	25428377
MIRT054193	hsa-miR-29c-3p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	25428377
MIRT437424	hsa-miR-137	Luciferase reporter assay, qRT-PCR, Western blot	24465609
MIRT054191	hsa-miR-29a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot, Cell proliferation, apoptosis, cell cycle assays	24076586
MIRT054191	hsa-miR-29a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot, Cell proliferation, apoptosis, cell cycle assays	24076586
MIRT054191	hsa-miR-29a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot, Cell proliferation, apoptosis, cell cycle assays	24076586
MIRT054191	hsa-miR-29a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot, Cell proliferation, apoptosis, cell cycle assays	24076586
MIRT437424	hsa-miR-137	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26102366
MIRT437424	hsa-miR-137	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26102366
MIRT437424	hsa-miR-137	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26102366
MIRT437424	hsa-miR-137	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26102366
MIRT438208	hsa-miR-302b-3p	qRT-PCR, Western blot	24337067
MIRT438208	hsa-miR-302b-3p	qRT-PCR, Western blot	24337067
MIRT437977	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25288334
MIRT437977	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25288334
MIRT437976	hsa-let-7g-5p	Luciferase reporter assay, qRT-PCR, Western blot	25288334
MIRT437976	hsa-let-7g-5p	Luciferase reporter assay, qRT-PCR, Western blot	25288334
MIRT437424	hsa-miR-137	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26102366
MIRT437424	hsa-miR-137	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26102366
MIRT437424	hsa-miR-137	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26102366
MIRT437424	hsa-miR-137	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26102366
MIRT438208	hsa-miR-302b-3p	qRT-PCR, Western blot	24337067
MIRT438208	hsa-miR-302b-3p	qRT-PCR, Western blot	24337067
MIRT437977	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25288334
MIRT437977	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR, Western blot	25288334
MIRT437976	hsa-let-7g-5p	Luciferase reporter assay, qRT-PCR, Western blot	25288334
MIRT437976	hsa-let-7g-5p	Luciferase reporter assay, qRT-PCR, Western blot	25288334
MIRT568554	hsa-miR-126-3p	PAR-CLIP	20371350
MIRT437424	hsa-miR-137	PAR-CLIP	20371350
MIRT568553	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT568552	hsa-miR-4753-5p	PAR-CLIP	20371350
MIRT568551	hsa-miR-4517	PAR-CLIP	20371350
MIRT568550	hsa-miR-7845-5p	PAR-CLIP	20371350
MIRT568549	hsa-miR-3678-5p	PAR-CLIP	20371350
MIRT568548	hsa-miR-151a-5p	PAR-CLIP	20371350
MIRT568547	hsa-miR-151b	PAR-CLIP	20371350
MIRT000425	hsa-miR-184	PAR-CLIP	20371350
MIRT568546	hsa-miR-92b-5p	PAR-CLIP	20371350
MIRT568545	hsa-miR-1273e	PAR-CLIP	20371350
MIRT054192	hsa-miR-29b-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Microarray, Western blot	25263462
MIRT054192	hsa-miR-29b-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Microarray, Western blot	25263462
MIRT054191	hsa-miR-29a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26512921
MIRT054191	hsa-miR-29a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26512921
MIRT731613	hsa-miR-2861	Luciferase reporter assay, Western blot	27364926
MIRT731613	hsa-miR-2861	Luciferase reporter assay, Western blot	27364926
MIRT731613	hsa-miR-2861	Luciferase reporter assay, Western blot	27364926
MIRT731613	hsa-miR-2861	Luciferase reporter assay, Western blot	27364926
MIRT731613	hsa-miR-2861	Luciferase reporter assay, Western blot	27364926
MIRT731613	hsa-miR-2861	Luciferase reporter assay, Western blot	27364926
MIRT000425	hsa-miR-184	Luciferase reporter assay, qRT-PCR	27418134
MIRT000425	hsa-miR-184	Luciferase reporter assay, qRT-PCR	27418134
MIRT000425	hsa-miR-184	Luciferase reporter assay, qRT-PCR	27418134
MIRT000425	hsa-miR-184	Luciferase reporter assay, qRT-PCR	27418134
MIRT000425	hsa-miR-184	Luciferase reporter assay, qRT-PCR	27418134
MIRT000425	hsa-miR-184	Luciferase reporter assay, qRT-PCR	27418134
MIRT022768	hsa-miR-124-3p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	27175587
MIRT053175	hsa-miR-612	Luciferase reporter assay, qRT-PCR, Western blot	26158514
MIRT053175	hsa-miR-612	Luciferase reporter assay, qRT-PCR, Western blot	26158514
MIRT733787	hsa-miR-625-5p	Luciferase reporter assay	33768461
MIRT737451	hsa-miR-22-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	31802908
MIRT568554	hsa-miR-126-3p	PAR-CLIP	20371350
MIRT437424	hsa-miR-137	PAR-CLIP	20371350
MIRT568553	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT568552	hsa-miR-4753-5p	PAR-CLIP	20371350
MIRT568551	hsa-miR-4517	PAR-CLIP	20371350
MIRT568550	hsa-miR-7845-5p	PAR-CLIP	20371350
MIRT568549	hsa-miR-3678-5p	PAR-CLIP	20371350
MIRT568548	hsa-miR-151a-5p	PAR-CLIP	20371350
MIRT568547	hsa-miR-151b	PAR-CLIP	20371350
MIRT000425	hsa-miR-184	PAR-CLIP	20371350
MIRT568546	hsa-miR-92b-5p	PAR-CLIP	20371350
MIRT568545	hsa-miR-1273e	PAR-CLIP	20371350
MIRT568554	hsa-miR-126-3p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Flow cytometry	34320278
MIRT776522	hsa-miR-103b	CLIP-seq
MIRT776523	hsa-miR-105	CLIP-seq
MIRT776524	hsa-miR-1184	CLIP-seq
MIRT776525	hsa-miR-1205	CLIP-seq
MIRT776526	hsa-miR-1207-3p	CLIP-seq
MIRT776527	hsa-miR-1207-5p	CLIP-seq
MIRT776528	hsa-miR-122	CLIP-seq
MIRT776529	hsa-miR-1224-3p	CLIP-seq
MIRT776530	hsa-miR-1234	CLIP-seq
MIRT776531	hsa-miR-1254	CLIP-seq
MIRT776532	hsa-miR-1275	CLIP-seq
MIRT776533	hsa-miR-128	CLIP-seq
MIRT776534	hsa-miR-1285	CLIP-seq
MIRT776535	hsa-miR-1289	CLIP-seq
MIRT776536	hsa-miR-1321	CLIP-seq
MIRT776537	hsa-miR-146a	CLIP-seq
MIRT776538	hsa-miR-146b-3p	CLIP-seq
MIRT776539	hsa-miR-146b-5p	CLIP-seq
MIRT776540	hsa-miR-1470	CLIP-seq
MIRT776541	hsa-miR-148a	CLIP-seq
MIRT776542	hsa-miR-148b	CLIP-seq
MIRT776543	hsa-miR-150	CLIP-seq
MIRT776544	hsa-miR-151-5p	CLIP-seq
MIRT776545	hsa-miR-152	CLIP-seq
MIRT776546	hsa-miR-1827	CLIP-seq
MIRT776547	hsa-miR-1909	CLIP-seq
MIRT776548	hsa-miR-1911	CLIP-seq
MIRT776549	hsa-miR-208a	CLIP-seq
MIRT776550	hsa-miR-208b	CLIP-seq
MIRT776551	hsa-miR-2115	CLIP-seq
MIRT776552	hsa-miR-23a	CLIP-seq
MIRT776553	hsa-miR-23b	CLIP-seq
MIRT776554	hsa-miR-23c	CLIP-seq
MIRT776555	hsa-miR-2467-5p	CLIP-seq
MIRT776556	hsa-miR-27a	CLIP-seq
MIRT776557	hsa-miR-27b	CLIP-seq
MIRT776558	hsa-miR-29a	CLIP-seq
MIRT776559	hsa-miR-29b	CLIP-seq
MIRT776560	hsa-miR-29c	CLIP-seq
MIRT776561	hsa-miR-302f	CLIP-seq
MIRT776562	hsa-miR-3065-3p	CLIP-seq
MIRT776563	hsa-miR-3116	CLIP-seq
MIRT776564	hsa-miR-3120-3p	CLIP-seq
MIRT776565	hsa-miR-3125	CLIP-seq
MIRT776566	hsa-miR-3135b	CLIP-seq
MIRT776567	hsa-miR-3148	CLIP-seq
MIRT776568	hsa-miR-3150b-3p	CLIP-seq
MIRT776569	hsa-miR-3151	CLIP-seq
MIRT776570	hsa-miR-3156-3p	CLIP-seq
MIRT776571	hsa-miR-3183	CLIP-seq
MIRT776572	hsa-miR-3184	CLIP-seq
MIRT776573	hsa-miR-3185	CLIP-seq
MIRT776574	hsa-miR-3187-5p	CLIP-seq
MIRT776575	hsa-miR-3188	CLIP-seq
MIRT776576	hsa-miR-3192	CLIP-seq
MIRT776577	hsa-miR-3198	CLIP-seq
MIRT776578	hsa-miR-329	CLIP-seq
MIRT776579	hsa-miR-339-5p	CLIP-seq
MIRT776580	hsa-miR-342-3p	CLIP-seq
MIRT776581	hsa-miR-342-5p	CLIP-seq
MIRT776582	hsa-miR-3545-5p	CLIP-seq
MIRT776583	hsa-miR-3612	CLIP-seq
MIRT776584	hsa-miR-361-3p	CLIP-seq
MIRT776585	hsa-miR-3616-3p	CLIP-seq
MIRT776586	hsa-miR-362-3p	CLIP-seq
MIRT776587	hsa-miR-365	CLIP-seq
MIRT776588	hsa-miR-3652	CLIP-seq
MIRT776589	hsa-miR-3659	CLIP-seq
MIRT776590	hsa-miR-3662	CLIP-seq
MIRT776591	hsa-miR-3667-5p	CLIP-seq
MIRT776592	hsa-miR-3689a-3p	CLIP-seq
MIRT776593	hsa-miR-3689c	CLIP-seq
MIRT776594	hsa-miR-3689d	CLIP-seq
MIRT776595	hsa-miR-371-5p	CLIP-seq
MIRT776596	hsa-miR-377	CLIP-seq
MIRT776597	hsa-miR-378g	CLIP-seq
MIRT776598	hsa-miR-3916	CLIP-seq
MIRT776599	hsa-miR-3922-5p	CLIP-seq
MIRT776600	hsa-miR-3940-3p	CLIP-seq
MIRT776601	hsa-miR-3943	CLIP-seq
MIRT776602	hsa-miR-3975	CLIP-seq
MIRT776603	hsa-miR-423-5p	CLIP-seq
MIRT776604	hsa-miR-4252	CLIP-seq
MIRT776605	hsa-miR-4254	CLIP-seq
MIRT776606	hsa-miR-4260	CLIP-seq
MIRT776607	hsa-miR-4268	CLIP-seq
MIRT776608	hsa-miR-4270	CLIP-seq
MIRT776609	hsa-miR-4283	CLIP-seq
MIRT776610	hsa-miR-4294	CLIP-seq
MIRT776611	hsa-miR-4301	CLIP-seq
MIRT776612	hsa-miR-4309	CLIP-seq
MIRT776613	hsa-miR-4313	CLIP-seq
MIRT776614	hsa-miR-4314	CLIP-seq
MIRT776615	hsa-miR-4316	CLIP-seq
MIRT776616	hsa-miR-4418	CLIP-seq
MIRT776617	hsa-miR-4430	CLIP-seq
MIRT776618	hsa-miR-4432	CLIP-seq
MIRT776619	hsa-miR-4436b-3p	CLIP-seq
MIRT776620	hsa-miR-4438	CLIP-seq
MIRT776621	hsa-miR-4441	CLIP-seq
MIRT776622	hsa-miR-4443	CLIP-seq
MIRT776623	hsa-miR-4459	CLIP-seq
MIRT776624	hsa-miR-4477a	CLIP-seq
MIRT776625	hsa-miR-4486	CLIP-seq
MIRT776626	hsa-miR-4488	CLIP-seq
MIRT776627	hsa-miR-4489	CLIP-seq
MIRT776628	hsa-miR-4512	CLIP-seq
MIRT776629	hsa-miR-4525	CLIP-seq
MIRT776630	hsa-miR-4643	CLIP-seq
MIRT776631	hsa-miR-4646-5p	CLIP-seq
MIRT776632	hsa-miR-4650-5p	CLIP-seq
MIRT776633	hsa-miR-4651	CLIP-seq
MIRT776634	hsa-miR-4658	CLIP-seq
MIRT776635	hsa-miR-4660	CLIP-seq
MIRT776636	hsa-miR-4664-5p	CLIP-seq
MIRT776637	hsa-miR-4665-5p	CLIP-seq
MIRT776638	hsa-miR-4667-3p	CLIP-seq
MIRT776639	hsa-miR-4690-3p	CLIP-seq
MIRT776640	hsa-miR-4695-5p	CLIP-seq
MIRT776641	hsa-miR-4697-5p	CLIP-seq
MIRT776642	hsa-miR-4698	CLIP-seq
MIRT776643	hsa-miR-4707-3p	CLIP-seq
MIRT776644	hsa-miR-4710	CLIP-seq
MIRT776645	hsa-miR-4711-3p	CLIP-seq
MIRT776646	hsa-miR-4721	CLIP-seq
MIRT776647	hsa-miR-4723-3p	CLIP-seq
MIRT776648	hsa-miR-4723-5p	CLIP-seq
MIRT776649	hsa-miR-4728-5p	CLIP-seq
MIRT776650	hsa-miR-4731-5p	CLIP-seq
MIRT776651	hsa-miR-4739	CLIP-seq
MIRT776652	hsa-miR-4756-5p	CLIP-seq
MIRT776653	hsa-miR-4763-3p	CLIP-seq
MIRT776654	hsa-miR-4780	CLIP-seq
MIRT776655	hsa-miR-4784	CLIP-seq
MIRT776656	hsa-miR-485-5p	CLIP-seq
MIRT776657	hsa-miR-486-3p	CLIP-seq
MIRT776658	hsa-miR-490-5p	CLIP-seq
MIRT776659	hsa-miR-499-5p	CLIP-seq
MIRT776660	hsa-miR-501-3p	CLIP-seq
MIRT776661	hsa-miR-502-3p	CLIP-seq
MIRT776662	hsa-miR-509-3-5p	CLIP-seq
MIRT776663	hsa-miR-5095	CLIP-seq
MIRT776664	hsa-miR-509-5p	CLIP-seq
MIRT776665	hsa-miR-511	CLIP-seq
MIRT776666	hsa-miR-515-5p	CLIP-seq
MIRT776667	hsa-miR-532-3p	CLIP-seq
MIRT776668	hsa-miR-574-5p	CLIP-seq
MIRT776669	hsa-miR-582-3p	CLIP-seq
MIRT776670	hsa-miR-608	CLIP-seq
MIRT776671	hsa-miR-623	CLIP-seq
MIRT776672	hsa-miR-625	CLIP-seq
MIRT776673	hsa-miR-637	CLIP-seq
MIRT776674	hsa-miR-646	CLIP-seq
MIRT776675	hsa-miR-650	CLIP-seq
MIRT776676	hsa-miR-661	CLIP-seq
MIRT776677	hsa-miR-665	CLIP-seq
MIRT776678	hsa-miR-767-5p	CLIP-seq
MIRT776679	hsa-miR-875-3p	CLIP-seq
MIRT776680	hsa-miR-888	CLIP-seq
MIRT776681	hsa-miR-924	CLIP-seq
MIRT776682	hsa-miR-940	CLIP-seq
MIRT776619	hsa-miR-4436b-3p	CLIP-seq
MIRT776522	hsa-miR-103b	CLIP-seq
MIRT776523	hsa-miR-105	CLIP-seq
MIRT776524	hsa-miR-1184	CLIP-seq
MIRT776525	hsa-miR-1205	CLIP-seq
MIRT776526	hsa-miR-1207-3p	CLIP-seq
MIRT776527	hsa-miR-1207-5p	CLIP-seq
MIRT1929247	hsa-miR-1225-3p	CLIP-seq
MIRT1929248	hsa-miR-1226	CLIP-seq
MIRT1929249	hsa-miR-1233	CLIP-seq
MIRT1929250	hsa-miR-124	CLIP-seq
MIRT1929251	hsa-miR-1252	CLIP-seq
MIRT776531	hsa-miR-1254	CLIP-seq
MIRT776533	hsa-miR-128	CLIP-seq
MIRT776535	hsa-miR-1289	CLIP-seq
MIRT1929252	hsa-miR-1291	CLIP-seq
MIRT1929253	hsa-miR-136	CLIP-seq
MIRT1929254	hsa-miR-138	CLIP-seq
MIRT776537	hsa-miR-146a	CLIP-seq
MIRT776539	hsa-miR-146b-5p	CLIP-seq
MIRT776541	hsa-miR-148a	CLIP-seq
MIRT776542	hsa-miR-148b	CLIP-seq
MIRT776545	hsa-miR-152	CLIP-seq
MIRT1929255	hsa-miR-15a	CLIP-seq
MIRT1929256	hsa-miR-15b	CLIP-seq
MIRT1929257	hsa-miR-16	CLIP-seq
MIRT776546	hsa-miR-1827	CLIP-seq
MIRT1929258	hsa-miR-185	CLIP-seq
MIRT1929259	hsa-miR-188-3p	CLIP-seq
MIRT776547	hsa-miR-1909	CLIP-seq
MIRT1929260	hsa-miR-1913	CLIP-seq
MIRT1929261	hsa-miR-1915	CLIP-seq
MIRT1929262	hsa-miR-194	CLIP-seq
MIRT1929263	hsa-miR-195	CLIP-seq
MIRT1929264	hsa-miR-197	CLIP-seq
MIRT1929265	hsa-miR-1972	CLIP-seq
MIRT1929266	hsa-miR-1976	CLIP-seq
MIRT1929267	hsa-miR-200b	CLIP-seq
MIRT1929268	hsa-miR-200c	CLIP-seq
MIRT1929269	hsa-miR-2467-3p	CLIP-seq
MIRT776556	hsa-miR-27a	CLIP-seq
MIRT776557	hsa-miR-27b	CLIP-seq
MIRT776558	hsa-miR-29a	CLIP-seq
MIRT776559	hsa-miR-29b	CLIP-seq
MIRT776560	hsa-miR-29c	CLIP-seq
MIRT776562	hsa-miR-3065-3p	CLIP-seq
MIRT776563	hsa-miR-3116	CLIP-seq
MIRT776566	hsa-miR-3135b	CLIP-seq
MIRT1929270	hsa-miR-3136-3p	CLIP-seq
MIRT776567	hsa-miR-3148	CLIP-seq
MIRT776568	hsa-miR-3150b-3p	CLIP-seq
MIRT776569	hsa-miR-3151	CLIP-seq
MIRT776570	hsa-miR-3156-3p	CLIP-seq
MIRT1929271	hsa-miR-3166	CLIP-seq
MIRT776572	hsa-miR-3184	CLIP-seq
MIRT776573	hsa-miR-3185	CLIP-seq
MIRT776576	hsa-miR-3192	CLIP-seq
MIRT1929272	hsa-miR-3202	CLIP-seq
MIRT1929273	hsa-miR-323b-3p	CLIP-seq
MIRT1929274	hsa-miR-324-3p	CLIP-seq
MIRT1929275	hsa-miR-328	CLIP-seq
MIRT776578	hsa-miR-329	CLIP-seq
MIRT776581	hsa-miR-342-5p	CLIP-seq
MIRT1929276	hsa-miR-3545-3p	CLIP-seq
MIRT776582	hsa-miR-3545-5p	CLIP-seq
MIRT776583	hsa-miR-3612	CLIP-seq
MIRT776584	hsa-miR-361-3p	CLIP-seq
MIRT776585	hsa-miR-3616-3p	CLIP-seq
MIRT1929277	hsa-miR-3622a-5p	CLIP-seq
MIRT776586	hsa-miR-362-3p	CLIP-seq
MIRT1929278	hsa-miR-3651	CLIP-seq
MIRT776588	hsa-miR-3652	CLIP-seq
MIRT1929279	hsa-miR-3675-5p	CLIP-seq
MIRT1929280	hsa-miR-3678-3p	CLIP-seq
MIRT1929281	hsa-miR-3679-3p	CLIP-seq
MIRT776592	hsa-miR-3689a-3p	CLIP-seq
MIRT776593	hsa-miR-3689c	CLIP-seq
MIRT1929282	hsa-miR-3691-3p	CLIP-seq
MIRT1929283	hsa-miR-370	CLIP-seq
MIRT1929284	hsa-miR-3714	CLIP-seq
MIRT1929285	hsa-miR-3910	CLIP-seq
MIRT776601	hsa-miR-3943	CLIP-seq
MIRT1929286	hsa-miR-3978	CLIP-seq
MIRT776603	hsa-miR-423-5p	CLIP-seq
MIRT1929287	hsa-miR-424	CLIP-seq
MIRT776607	hsa-miR-4268	CLIP-seq
MIRT1929288	hsa-miR-4269	CLIP-seq
MIRT776608	hsa-miR-4270	CLIP-seq
MIRT776609	hsa-miR-4283	CLIP-seq
MIRT1929289	hsa-miR-429	CLIP-seq
MIRT1929290	hsa-miR-4290	CLIP-seq
MIRT1929291	hsa-miR-4293	CLIP-seq
MIRT776610	hsa-miR-4294	CLIP-seq
MIRT776611	hsa-miR-4301	CLIP-seq
MIRT1929292	hsa-miR-4306	CLIP-seq
MIRT776614	hsa-miR-4314	CLIP-seq
MIRT776615	hsa-miR-4316	CLIP-seq
MIRT1929293	hsa-miR-4323	CLIP-seq
MIRT776617	hsa-miR-4430	CLIP-seq
MIRT1929294	hsa-miR-4433	CLIP-seq
MIRT776619	hsa-miR-4436b-3p	CLIP-seq
MIRT776621	hsa-miR-4441	CLIP-seq
MIRT776622	hsa-miR-4443	CLIP-seq
MIRT1929295	hsa-miR-4447	CLIP-seq
MIRT1929296	hsa-miR-4456	CLIP-seq
MIRT1929297	hsa-miR-4464	CLIP-seq
MIRT1929298	hsa-miR-4472	CLIP-seq
MIRT776627	hsa-miR-4489	CLIP-seq
MIRT1929299	hsa-miR-4492	CLIP-seq
MIRT1929300	hsa-miR-4498	CLIP-seq
MIRT1929301	hsa-miR-4505	CLIP-seq
MIRT1929302	hsa-miR-4508	CLIP-seq
MIRT1929303	hsa-miR-4511	CLIP-seq
MIRT1929304	hsa-miR-4514	CLIP-seq
MIRT1929305	hsa-miR-4533	CLIP-seq
MIRT1929306	hsa-miR-4640-5p	CLIP-seq
MIRT1929307	hsa-miR-4644	CLIP-seq
MIRT776631	hsa-miR-4646-5p	CLIP-seq
MIRT776633	hsa-miR-4651	CLIP-seq
MIRT1929308	hsa-miR-4659a-5p	CLIP-seq
MIRT1929309	hsa-miR-4659b-5p	CLIP-seq
MIRT776635	hsa-miR-4660	CLIP-seq
MIRT776636	hsa-miR-4664-5p	CLIP-seq
MIRT1929310	hsa-miR-4668-5p	CLIP-seq
MIRT1929311	hsa-miR-4682	CLIP-seq
MIRT776639	hsa-miR-4690-3p	CLIP-seq
MIRT1929312	hsa-miR-4692	CLIP-seq
MIRT1929313	hsa-miR-4700-3p	CLIP-seq
MIRT776644	hsa-miR-4710	CLIP-seq
MIRT776645	hsa-miR-4711-3p	CLIP-seq
MIRT1929314	hsa-miR-4714-3p	CLIP-seq
MIRT776646	hsa-miR-4721	CLIP-seq
MIRT1929315	hsa-miR-4722-3p	CLIP-seq
MIRT1929316	hsa-miR-4726-3p	CLIP-seq
MIRT1929317	hsa-miR-4726-5p	CLIP-seq
MIRT776649	hsa-miR-4728-5p	CLIP-seq
MIRT776650	hsa-miR-4731-5p	CLIP-seq
MIRT1929318	hsa-miR-4733-3p	CLIP-seq
MIRT1929319	hsa-miR-4736	CLIP-seq
MIRT1929320	hsa-miR-4742-5p	CLIP-seq
MIRT1929321	hsa-miR-4748	CLIP-seq
MIRT776653	hsa-miR-4763-3p	CLIP-seq
MIRT1929322	hsa-miR-4769-3p	CLIP-seq
MIRT776655	hsa-miR-4784	CLIP-seq
MIRT1929323	hsa-miR-4792	CLIP-seq
MIRT1929324	hsa-miR-4802-3p	CLIP-seq
MIRT776658	hsa-miR-490-5p	CLIP-seq
MIRT1929325	hsa-miR-497	CLIP-seq
MIRT1929326	hsa-miR-503	CLIP-seq
MIRT1929327	hsa-miR-506	CLIP-seq
MIRT1929328	hsa-miR-508-3p	CLIP-seq
MIRT1929329	hsa-miR-510	CLIP-seq
MIRT776665	hsa-miR-511	CLIP-seq
MIRT1929330	hsa-miR-519a	CLIP-seq
MIRT1929331	hsa-miR-519b-3p	CLIP-seq
MIRT1929332	hsa-miR-519c-3p	CLIP-seq
MIRT776667	hsa-miR-532-3p	CLIP-seq
MIRT1929333	hsa-miR-564	CLIP-seq
MIRT1929334	hsa-miR-593	CLIP-seq
MIRT776670	hsa-miR-608	CLIP-seq
MIRT1929335	hsa-miR-626	CLIP-seq
MIRT1929336	hsa-miR-628-3p	CLIP-seq
MIRT1929337	hsa-miR-633	CLIP-seq
MIRT1929338	hsa-miR-634	CLIP-seq
MIRT1929339	hsa-miR-642b	CLIP-seq
MIRT776675	hsa-miR-650	CLIP-seq
MIRT1929340	hsa-miR-657	CLIP-seq
MIRT1929341	hsa-miR-658	CLIP-seq
MIRT1929342	hsa-miR-663b	CLIP-seq
MIRT1929343	hsa-miR-671-5p	CLIP-seq
MIRT1929344	hsa-miR-7	CLIP-seq
MIRT1929345	hsa-miR-762	CLIP-seq
MIRT776679	hsa-miR-875-3p	CLIP-seq
MIRT1929346	hsa-miR-892a	CLIP-seq
MIRT776681	hsa-miR-924	CLIP-seq
MIRT776682	hsa-miR-940	CLIP-seq
MIRT2169831	hsa-miR-103a	CLIP-seq
MIRT776522	hsa-miR-103b	CLIP-seq
MIRT776523	hsa-miR-105	CLIP-seq
MIRT2169832	hsa-miR-107	CLIP-seq
MIRT776524	hsa-miR-1184	CLIP-seq
MIRT776525	hsa-miR-1205	CLIP-seq
MIRT776526	hsa-miR-1207-3p	CLIP-seq
MIRT776527	hsa-miR-1207-5p	CLIP-seq
MIRT776528	hsa-miR-122	CLIP-seq
MIRT776529	hsa-miR-1224-3p	CLIP-seq
MIRT1929248	hsa-miR-1226	CLIP-seq
MIRT776530	hsa-miR-1234	CLIP-seq
MIRT1929250	hsa-miR-124	CLIP-seq
MIRT2169833	hsa-miR-1245	CLIP-seq
MIRT1929251	hsa-miR-1252	CLIP-seq
MIRT776531	hsa-miR-1254	CLIP-seq
MIRT2169834	hsa-miR-125a-5p	CLIP-seq
MIRT2169835	hsa-miR-125b	CLIP-seq
MIRT2169836	hsa-miR-1260	CLIP-seq
MIRT2169837	hsa-miR-1260b	CLIP-seq
MIRT776533	hsa-miR-128	CLIP-seq
MIRT2169838	hsa-miR-1280	CLIP-seq
MIRT2169839	hsa-miR-1288	CLIP-seq
MIRT776535	hsa-miR-1289	CLIP-seq
MIRT2169840	hsa-miR-129-5p	CLIP-seq
MIRT776536	hsa-miR-1321	CLIP-seq
MIRT2169841	hsa-miR-1343	CLIP-seq
MIRT1929254	hsa-miR-138	CLIP-seq
MIRT2169842	hsa-miR-143	CLIP-seq
MIRT776537	hsa-miR-146a	CLIP-seq
MIRT776539	hsa-miR-146b-5p	CLIP-seq
MIRT776543	hsa-miR-150	CLIP-seq
MIRT776546	hsa-miR-1827	CLIP-seq
MIRT1929259	hsa-miR-188-3p	CLIP-seq
MIRT776547	hsa-miR-1909	CLIP-seq
MIRT1929265	hsa-miR-1972	CLIP-seq
MIRT1929267	hsa-miR-200b	CLIP-seq
MIRT1929268	hsa-miR-200c	CLIP-seq
MIRT2169843	hsa-miR-203	CLIP-seq
MIRT776552	hsa-miR-23a	CLIP-seq
MIRT776553	hsa-miR-23b	CLIP-seq
MIRT776554	hsa-miR-23c	CLIP-seq
MIRT776555	hsa-miR-2467-5p	CLIP-seq
MIRT776556	hsa-miR-27a	CLIP-seq
MIRT776557	hsa-miR-27b	CLIP-seq
MIRT776558	hsa-miR-29a	CLIP-seq
MIRT776559	hsa-miR-29b	CLIP-seq
MIRT776560	hsa-miR-29c	CLIP-seq
MIRT776561	hsa-miR-302f	CLIP-seq
MIRT776562	hsa-miR-3065-3p	CLIP-seq
MIRT776563	hsa-miR-3116	CLIP-seq
MIRT2169844	hsa-miR-3120-5p	CLIP-seq
MIRT776566	hsa-miR-3135b	CLIP-seq
MIRT1929270	hsa-miR-3136-3p	CLIP-seq
MIRT776567	hsa-miR-3148	CLIP-seq
MIRT2169845	hsa-miR-3149	CLIP-seq
MIRT2169846	hsa-miR-3150a-3p	CLIP-seq
MIRT776568	hsa-miR-3150b-3p	CLIP-seq
MIRT776569	hsa-miR-3151	CLIP-seq
MIRT776570	hsa-miR-3156-3p	CLIP-seq
MIRT2169847	hsa-miR-3169	CLIP-seq
MIRT2169848	hsa-miR-3175	CLIP-seq
MIRT776572	hsa-miR-3184	CLIP-seq
MIRT776573	hsa-miR-3185	CLIP-seq
MIRT776575	hsa-miR-3188	CLIP-seq
MIRT776576	hsa-miR-3192	CLIP-seq
MIRT776577	hsa-miR-3198	CLIP-seq
MIRT1929272	hsa-miR-3202	CLIP-seq
MIRT1929273	hsa-miR-323b-3p	CLIP-seq
MIRT1929275	hsa-miR-328	CLIP-seq
MIRT776580	hsa-miR-342-3p	CLIP-seq
MIRT776581	hsa-miR-342-5p	CLIP-seq
MIRT2169849	hsa-miR-346	CLIP-seq
MIRT776582	hsa-miR-3545-5p	CLIP-seq
MIRT776583	hsa-miR-3612	CLIP-seq
MIRT776584	hsa-miR-361-3p	CLIP-seq
MIRT776585	hsa-miR-3616-3p	CLIP-seq
MIRT1929277	hsa-miR-3622a-5p	CLIP-seq
MIRT776588	hsa-miR-3652	CLIP-seq
MIRT776589	hsa-miR-3659	CLIP-seq
MIRT2169850	hsa-miR-3674	CLIP-seq
MIRT1929279	hsa-miR-3675-5p	CLIP-seq
MIRT776592	hsa-miR-3689a-3p	CLIP-seq
MIRT776593	hsa-miR-3689c	CLIP-seq
MIRT776594	hsa-miR-3689d	CLIP-seq
MIRT1929282	hsa-miR-3691-3p	CLIP-seq
MIRT1929284	hsa-miR-3714	CLIP-seq
MIRT776595	hsa-miR-371-5p	CLIP-seq
MIRT776596	hsa-miR-377	CLIP-seq
MIRT776597	hsa-miR-378g	CLIP-seq
MIRT2169851	hsa-miR-3909	CLIP-seq
MIRT1929285	hsa-miR-3910	CLIP-seq
MIRT776601	hsa-miR-3943	CLIP-seq
MIRT776602	hsa-miR-3975	CLIP-seq
MIRT776603	hsa-miR-423-5p	CLIP-seq
MIRT776605	hsa-miR-4254	CLIP-seq
MIRT776607	hsa-miR-4268	CLIP-seq
MIRT1929288	hsa-miR-4269	CLIP-seq
MIRT2169852	hsa-miR-4278	CLIP-seq
MIRT776609	hsa-miR-4283	CLIP-seq
MIRT2169853	hsa-miR-4288	CLIP-seq
MIRT1929289	hsa-miR-429	CLIP-seq
MIRT1929290	hsa-miR-4290	CLIP-seq
MIRT776610	hsa-miR-4294	CLIP-seq
MIRT776611	hsa-miR-4301	CLIP-seq
MIRT776612	hsa-miR-4309	CLIP-seq
MIRT776614	hsa-miR-4314	CLIP-seq
MIRT776615	hsa-miR-4316	CLIP-seq
MIRT2169854	hsa-miR-4319	CLIP-seq
MIRT1929293	hsa-miR-4323	CLIP-seq
MIRT776616	hsa-miR-4418	CLIP-seq
MIRT2169855	hsa-miR-4419a	CLIP-seq
MIRT776617	hsa-miR-4430	CLIP-seq
MIRT2169856	hsa-miR-4437	CLIP-seq
MIRT776622	hsa-miR-4443	CLIP-seq
MIRT1929297	hsa-miR-4464	CLIP-seq
MIRT776625	hsa-miR-4486	CLIP-seq
MIRT776627	hsa-miR-4489	CLIP-seq
MIRT1929299	hsa-miR-4492	CLIP-seq
MIRT1929300	hsa-miR-4498	CLIP-seq
MIRT1929301	hsa-miR-4505	CLIP-seq
MIRT1929302	hsa-miR-4508	CLIP-seq
MIRT2169857	hsa-miR-4509	CLIP-seq
MIRT2169858	hsa-miR-4510	CLIP-seq
MIRT1929303	hsa-miR-4511	CLIP-seq
MIRT776628	hsa-miR-4512	CLIP-seq
MIRT1929304	hsa-miR-4514	CLIP-seq
MIRT2169859	hsa-miR-4520a-5p	CLIP-seq
MIRT2169860	hsa-miR-4520b-5p	CLIP-seq
MIRT1929305	hsa-miR-4533	CLIP-seq
MIRT1929306	hsa-miR-4640-5p	CLIP-seq
MIRT776630	hsa-miR-4643	CLIP-seq
MIRT2169861	hsa-miR-4645-5p	CLIP-seq
MIRT776631	hsa-miR-4646-5p	CLIP-seq
MIRT776632	hsa-miR-4650-5p	CLIP-seq
MIRT776633	hsa-miR-4651	CLIP-seq
MIRT776634	hsa-miR-4658	CLIP-seq
MIRT776636	hsa-miR-4664-5p	CLIP-seq
MIRT2169862	hsa-miR-4667-5p	CLIP-seq
MIRT1929310	hsa-miR-4668-5p	CLIP-seq
MIRT2169863	hsa-miR-4673	CLIP-seq
MIRT2169864	hsa-miR-4674	CLIP-seq
MIRT776639	hsa-miR-4690-3p	CLIP-seq
MIRT2169865	hsa-miR-4691-3p	CLIP-seq
MIRT1929312	hsa-miR-4692	CLIP-seq
MIRT1929313	hsa-miR-4700-3p	CLIP-seq
MIRT2169866	hsa-miR-4700-5p	CLIP-seq
MIRT2169867	hsa-miR-4708-5p	CLIP-seq
MIRT776644	hsa-miR-4710	CLIP-seq
MIRT776645	hsa-miR-4711-3p	CLIP-seq
MIRT1929314	hsa-miR-4714-3p	CLIP-seq
MIRT2169868	hsa-miR-4716-3p	CLIP-seq
MIRT776646	hsa-miR-4721	CLIP-seq
MIRT1929317	hsa-miR-4726-5p	CLIP-seq
MIRT776649	hsa-miR-4728-5p	CLIP-seq
MIRT776650	hsa-miR-4731-5p	CLIP-seq
MIRT2169869	hsa-miR-4732-3p	CLIP-seq
MIRT2169870	hsa-miR-4732-5p	CLIP-seq
MIRT2169871	hsa-miR-4735-5p	CLIP-seq
MIRT1929319	hsa-miR-4736	CLIP-seq
MIRT2169872	hsa-miR-4738-5p	CLIP-seq
MIRT776651	hsa-miR-4739	CLIP-seq
MIRT1929320	hsa-miR-4742-5p	CLIP-seq
MIRT1929321	hsa-miR-4748	CLIP-seq
MIRT2169873	hsa-miR-4755-3p	CLIP-seq
MIRT776652	hsa-miR-4756-5p	CLIP-seq
MIRT776653	hsa-miR-4763-3p	CLIP-seq
MIRT2169874	hsa-miR-4770	CLIP-seq
MIRT2169875	hsa-miR-4775	CLIP-seq
MIRT776655	hsa-miR-4784	CLIP-seq
MIRT1929324	hsa-miR-4802-3p	CLIP-seq
MIRT776656	hsa-miR-485-5p	CLIP-seq
MIRT776657	hsa-miR-486-3p	CLIP-seq
MIRT776658	hsa-miR-490-5p	CLIP-seq
MIRT776660	hsa-miR-501-3p	CLIP-seq
MIRT776661	hsa-miR-502-3p	CLIP-seq
MIRT1929327	hsa-miR-506	CLIP-seq
MIRT776662	hsa-miR-509-3-5p	CLIP-seq
MIRT776664	hsa-miR-509-5p	CLIP-seq
MIRT1929329	hsa-miR-510	CLIP-seq
MIRT776665	hsa-miR-511	CLIP-seq
MIRT776667	hsa-miR-532-3p	CLIP-seq
MIRT2169876	hsa-miR-548aa	CLIP-seq
MIRT2169877	hsa-miR-548ac	CLIP-seq
MIRT2169878	hsa-miR-548d-3p	CLIP-seq
MIRT2169879	hsa-miR-548z	CLIP-seq
MIRT1929333	hsa-miR-564	CLIP-seq
MIRT776668	hsa-miR-574-5p	CLIP-seq
MIRT2169880	hsa-miR-590-3p	CLIP-seq
MIRT1929334	hsa-miR-593	CLIP-seq
MIRT776670	hsa-miR-608	CLIP-seq
MIRT776672	hsa-miR-625	CLIP-seq
MIRT1929336	hsa-miR-628-3p	CLIP-seq
MIRT2169881	hsa-miR-632	CLIP-seq
MIRT1929339	hsa-miR-642b	CLIP-seq
MIRT776675	hsa-miR-650	CLIP-seq
MIRT1929340	hsa-miR-657	CLIP-seq
MIRT776676	hsa-miR-661	CLIP-seq
MIRT2169882	hsa-miR-670	CLIP-seq
MIRT1929343	hsa-miR-671-5p	CLIP-seq
MIRT1929345	hsa-miR-762	CLIP-seq
MIRT776678	hsa-miR-767-5p	CLIP-seq
MIRT776679	hsa-miR-875-3p	CLIP-seq
MIRT2169883	hsa-miR-885-3p	CLIP-seq
MIRT776681	hsa-miR-924	CLIP-seq
MIRT2169884	hsa-miR-939	CLIP-seq
MIRT776682	hsa-miR-940	CLIP-seq
MIRT776526	hsa-miR-1207-3p	CLIP-seq
MIRT776533	hsa-miR-128	CLIP-seq
MIRT776556	hsa-miR-27a	CLIP-seq
MIRT776557	hsa-miR-27b	CLIP-seq
MIRT776569	hsa-miR-3151	CLIP-seq
MIRT776570	hsa-miR-3156-3p	CLIP-seq
MIRT776585	hsa-miR-3616-3p	CLIP-seq
MIRT776607	hsa-miR-4268	CLIP-seq
MIRT776609	hsa-miR-4283	CLIP-seq
MIRT776611	hsa-miR-4301	CLIP-seq
MIRT776627	hsa-miR-4489	CLIP-seq
MIRT776646	hsa-miR-4721	CLIP-seq
MIRT776667	hsa-miR-532-3p	CLIP-seq
MIRT776674	hsa-miR-646	CLIP-seq
MIRT776682	hsa-miR-940	CLIP-seq
MIRT776548	hsa-miR-1911	CLIP-seq
MIRT776558	hsa-miR-29a	CLIP-seq
MIRT776559	hsa-miR-29b	CLIP-seq
MIRT776560	hsa-miR-29c	CLIP-seq
MIRT776562	hsa-miR-3065-3p	CLIP-seq
MIRT776590	hsa-miR-3662	CLIP-seq
MIRT776599	hsa-miR-3922-5p	CLIP-seq
MIRT776642	hsa-miR-4698	CLIP-seq
MIRT776680	hsa-miR-888	CLIP-seq
MIRT776522	hsa-miR-103b	CLIP-seq
MIRT1929247	hsa-miR-1225-3p	CLIP-seq
MIRT1929249	hsa-miR-1233	CLIP-seq
MIRT2169840	hsa-miR-129-5p	CLIP-seq
MIRT2169842	hsa-miR-143	CLIP-seq
MIRT2169845	hsa-miR-3149	CLIP-seq
MIRT776584	hsa-miR-361-3p	CLIP-seq
MIRT1929278	hsa-miR-3651	CLIP-seq
MIRT2169850	hsa-miR-3674	CLIP-seq
MIRT776601	hsa-miR-3943	CLIP-seq
MIRT1929293	hsa-miR-4323	CLIP-seq
MIRT2443525	hsa-miR-4632	CLIP-seq
MIRT776639	hsa-miR-4690-3p	CLIP-seq
MIRT2169870	hsa-miR-4732-5p	CLIP-seq
MIRT2169871	hsa-miR-4735-5p	CLIP-seq
MIRT2169874	hsa-miR-4770	CLIP-seq
MIRT2169875	hsa-miR-4775	CLIP-seq
MIRT1929323	hsa-miR-4792	CLIP-seq
MIRT776660	hsa-miR-501-3p	CLIP-seq
MIRT776661	hsa-miR-502-3p	CLIP-seq
MIRT2169880	hsa-miR-590-3p	CLIP-seq
MIRT776678	hsa-miR-767-5p	CLIP-seq
MIRT776522	hsa-miR-103b	CLIP-seq
MIRT776524	hsa-miR-1184	CLIP-seq
MIRT2169840	hsa-miR-129-5p	CLIP-seq
MIRT2169841	hsa-miR-1343	CLIP-seq
MIRT776548	hsa-miR-1911	CLIP-seq
MIRT776558	hsa-miR-29a	CLIP-seq
MIRT776559	hsa-miR-29b	CLIP-seq
MIRT776560	hsa-miR-29c	CLIP-seq
MIRT776562	hsa-miR-3065-3p	CLIP-seq
MIRT2169845	hsa-miR-3149	CLIP-seq
MIRT776590	hsa-miR-3662	CLIP-seq
MIRT2169850	hsa-miR-3674	CLIP-seq
MIRT776595	hsa-miR-371-5p	CLIP-seq
MIRT776597	hsa-miR-378g	CLIP-seq
MIRT776599	hsa-miR-3922-5p	CLIP-seq
MIRT776616	hsa-miR-4418	CLIP-seq
MIRT2169856	hsa-miR-4437	CLIP-seq
MIRT2169864	hsa-miR-4674	CLIP-seq
MIRT776642	hsa-miR-4698	CLIP-seq
MIRT2169870	hsa-miR-4732-5p	CLIP-seq
MIRT2169871	hsa-miR-4735-5p	CLIP-seq
MIRT2169875	hsa-miR-4775	CLIP-seq
MIRT776660	hsa-miR-501-3p	CLIP-seq
MIRT776661	hsa-miR-502-3p	CLIP-seq
MIRT776662	hsa-miR-509-3-5p	CLIP-seq
MIRT776664	hsa-miR-509-5p	CLIP-seq
MIRT2169880	hsa-miR-590-3p	CLIP-seq
MIRT776678	hsa-miR-767-5p	CLIP-seq
MIRT776680	hsa-miR-888	CLIP-seq
MIRT776522	hsa-miR-103b	CLIP-seq
MIRT776524	hsa-miR-1184	CLIP-seq
MIRT1929252	hsa-miR-1291	CLIP-seq
MIRT2169840	hsa-miR-129-5p	CLIP-seq
MIRT2169841	hsa-miR-1343	CLIP-seq
MIRT776548	hsa-miR-1911	CLIP-seq
MIRT2674872	hsa-miR-298	CLIP-seq
MIRT776558	hsa-miR-29a	CLIP-seq
MIRT776559	hsa-miR-29b	CLIP-seq
MIRT776560	hsa-miR-29c	CLIP-seq
MIRT776562	hsa-miR-3065-3p	CLIP-seq
MIRT2169845	hsa-miR-3149	CLIP-seq
MIRT2169846	hsa-miR-3150a-3p	CLIP-seq
MIRT776569	hsa-miR-3151	CLIP-seq
MIRT2674873	hsa-miR-3158-5p	CLIP-seq
MIRT2169848	hsa-miR-3175	CLIP-seq
MIRT776578	hsa-miR-329	CLIP-seq
MIRT776586	hsa-miR-362-3p	CLIP-seq
MIRT776590	hsa-miR-3662	CLIP-seq
MIRT2169850	hsa-miR-3674	CLIP-seq
MIRT776595	hsa-miR-371-5p	CLIP-seq
MIRT776596	hsa-miR-377	CLIP-seq
MIRT776597	hsa-miR-378g	CLIP-seq
MIRT776599	hsa-miR-3922-5p	CLIP-seq
MIRT2674874	hsa-miR-4292	CLIP-seq
MIRT776616	hsa-miR-4418	CLIP-seq
MIRT2169856	hsa-miR-4437	CLIP-seq
MIRT776630	hsa-miR-4643	CLIP-seq
MIRT2169862	hsa-miR-4667-5p	CLIP-seq
MIRT2169864	hsa-miR-4674	CLIP-seq
MIRT776642	hsa-miR-4698	CLIP-seq
MIRT2169866	hsa-miR-4700-5p	CLIP-seq
MIRT1929314	hsa-miR-4714-3p	CLIP-seq
MIRT2169870	hsa-miR-4732-5p	CLIP-seq
MIRT2169871	hsa-miR-4735-5p	CLIP-seq
MIRT2169875	hsa-miR-4775	CLIP-seq
MIRT1929324	hsa-miR-4802-3p	CLIP-seq
MIRT776660	hsa-miR-501-3p	CLIP-seq
MIRT776661	hsa-miR-502-3p	CLIP-seq
MIRT776662	hsa-miR-509-3-5p	CLIP-seq
MIRT776664	hsa-miR-509-5p	CLIP-seq
MIRT2169880	hsa-miR-590-3p	CLIP-seq
MIRT2674875	hsa-miR-662	CLIP-seq
MIRT776678	hsa-miR-767-5p	CLIP-seq
MIRT776680	hsa-miR-888	CLIP-seq
MIRT2169884	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Repression	20514445
PROX1	Repression	22982861
RELA	Repression	20514445
TWIST1	Activation	21876555;22982861

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10983986, 16540465, 23444369
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	1409633, 21432781
GO:0005515	Function	Protein binding	IPI	10490823, 10983986, 12434148, 16417406, 16792529, 17030088, 19713527, 20059950, 20856200, 21291857, 21737686, 22939624, 23444369, 23823123, 27505672, 28514442, 32296183, 33961781
GO:0005524	Function	ATP binding	IDA	16540465
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	20059950
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	21432781
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	23444369
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	21432781
GO:0005938	Component	Cell cortex	IEA
GO:0005938	Component	Cell cortex	ISS
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0005978	Process	Glycogen biosynthetic process	IEA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	21432781
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IMP	16814735
GO:0008286	Process	Insulin receptor signaling pathway	TAS	21432781
GO:0010748	Process	Negative regulation of long-chain fatty acid import across plasma membrane	IMP	16814735
GO:0010907	Process	Positive regulation of glucose metabolic process	IMP	16814735
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030334	Process	Regulation of cell migration	TAS	21432781
GO:0030335	Process	Positive regulation of cell migration	IDA	25428377
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	IMP	16814735
GO:0032287	Process	Peripheral nervous system myelin maintenance	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0032587	Component	Ruffle membrane	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IMP	16814735
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0036211	Process	Protein modification process	TAS	1409633
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IBA
GO:0045444	Process	Fat cell differentiation	TAS	21432781
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IMP	16814735
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046326	Process	Positive regulation of D-glucose import	IMP	16814735
GO:0046872	Function	Metal ion binding	IEA
GO:0050821	Process	Protein stabilization	IMP	23444369
GO:0051726	Process	Regulation of cell cycle	TAS	21432781
GO:0060644	Process	Mammary gland epithelial cell differentiation	TAS	21432781
GO:0071486	Process	Cellular response to high light intensity	IEA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS
GO:0097473	Process	Retinal rod cell apoptotic process	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140677	Function	Molecular function activator activity	EXP	12517337
GO:1903676	Process	Positive regulation of cap-dependent translational initiation	IMP	23444369
GO:1903898	Process	Negative regulation of PERK-mediated unfolded protein response	IEA
GO:2000147	Process	Positive regulation of cell motility	IMP	17332325

Other IDs

• MIM: 164731
• HGNC: 392
• e!Ensembl: ENSG00000105221

Protein

• UniProt ID: P31751
• Protein name: RAC-beta serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase Akt-2) (Protein kinase B beta) (PKB beta) (RAC protein kinase beta) (RAC-PK-beta)
• Protein function: Serine/threonine kinase closely related to AKT1 and AKT3. All 3 enzymes, AKT1, AKT2 and AKT3, are collectively known as AKT kinase. AKT regulates many processes including metabolism, proliferation, cell survival, growth and angiogenesis, through
• PDB: 1GZK, 1GZN, 1GZO, 1MRV, 1MRY, 1O6K, 1O6L, 1P6S, 2JDO, 2JDR, 2UW9, 2X39, 2XH5, 3D0E, 3E87, 3E88, 3E8D, 8Q61, 9C1W
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	6 → 108	PH domain	Domain
  PF00069	Pkinase	152 → 409	Protein kinase domain	Domain
  PF00433	Pkinase_C	430 → 475	Protein kinase C terminal domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed in myoblasts (PubMed:17565718). {ECO:0000269|PubMed:17565718}.
• Sequence:

  MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
  QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
  DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
  KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
  LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
  ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
  LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
  KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
  E

• Sequence length: 481

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
Platinum drug resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Apelin signaling pathway
Osteoclast differentiation
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Neutrophil extracellular trap formation
Toll-like receptor signaling pathway
C-type lectin receptor signaling pathway
JAK-STAT signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Regulation of lipolysis in adipocytes
Relaxin signaling pathway
GnRH secretion
Insulin resistance
Non-alcoholic fatty liver disease
AGE-RAGE signaling pathway in diabetic complications
Growth hormone synthesis, secretion and action
Alcoholic liver disease
Carbohydrate digestion and absorption
Alzheimer disease
Spinocerebellar ataxia
Shigellosis
Salmonella infection
Yersinia infection
Chagas disease
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Proteoglycans in cancer
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer
Diabetic cardiomyopathy
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Reactome:

PIP3 activates AKT signaling
Downregulation of ERBB2:ERBB3 signaling
Activation of AKT2
Inhibition of TSC complex formation by PKB
AKT phosphorylates targets in the cytosol
AKT phosphorylates targets in the nucleus
Negative regulation of the PI3K/AKT network
AKT-mediated inactivation of FOXO1A
Deactivation of the beta-catenin transactivating complex
CD28 dependent PI3K/Akt signaling
CTLA4 inhibitory signaling
G beta:gamma signalling through PI3Kgamma
VEGFR2 mediated vascular permeability
TP53 Regulates Metabolic Genes
Constitutive Signaling by AKT1 E17K in Cancer
Regulation of TP53 Degradation
Regulation of TP53 Activity through Acetylation
Regulation of TP53 Activity through Association with Co-factors
Cyclin E associated events during G1/S transition
Cyclin A:Cdk2-associated events at S phase entry
RAB GEFs exchange GTP for GDP on RABs
Regulation of PTEN stability and activity
Regulation of localization of FOXO transcription factors
Estrogen-dependent nuclear events downstream of ESR-membrane signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Hypoinsulinemic hypoglycemia and body hemihypertrophy	Pathogenic	rs387906659	RCV000022676	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Type 2 diabetes mellitus	Likely pathogenic; Pathogenic	rs121434593, rs387906659	RCV000015016 RCV005222699	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AKT2-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AKT2-RELATED FAMILIAL PARTIAL LIPODYSTROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NONINSULIN-DEPENDENT	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL PARTIAL LIPODYSTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL PARTIAL LIPODYSTROPHY KOBBERLING TYPE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL PARTIAL LIPODYSTROPHY, TYPE 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGLYCEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPODYSTROPHY, FAMILIAL PARTIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acanthosis Nigricans	Acanthosis Nigricans	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15102693		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27189341, 9496907		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17047397, 21182834, 21387307, 30942957		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	25285168		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28026019		★☆☆☆☆ Found in Text Mining only
AKT2-related familial partial lipodystrophy	Lipodystrophy	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	18492751		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	24642468		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	9496907		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18802016, 29588416		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20419126	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30628701		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17822324		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	18492751		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18802016, 29588416		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30692211		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21618512, 22771706		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30295140		★☆☆☆☆ Found in Text Mining only
Benign tumor of pancreas	Benign Tumor Of Pancreas	CGI_DG			★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20214684		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21836020, 27906180		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	27653874		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11507039, 12244303, 12569575, 14680486, 14681726, 16049961, 17332325, 21203579, 21297943, 22809628, 23499909, 24838891, 25520137, 27059323, 27175587, 28287129, 28853539, 29667444, 31357505, 31752925, 7657393		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19075277		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14680486, 19933843, 20471940, 21297943, 22809628, 23305873, 23929892, 24838891, 27097161, 27223437, 28478612, 29667444, 31781306, 32558176, 33378961, 35628294, 40403210	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	23449277	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16102584, 16721043, 17047397, 17351921, 22748472, 25502777, 27189341, 8622988, 9496907		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	22082146, 23435205	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22580126, 25424347, 26254095	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	30793508	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	26981779	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21836020, 27906180		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20354455, 21182834, 21387307, 24659658, 26234648, 26654940		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18254976	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25855050	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	22082146		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12144681, 12499249, 25894377, 26512921, 29374601, 8646743, 9916799		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29120957		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29079702		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30927374		★☆☆☆☆ Found in Text Mining only
Carnitine Palmitoyltransferase II Deficiency Infantile	Carnitine palmitoyltransferase deficiency	Pubtator	28566443	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30536701		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30536701		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	26823799	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24056770, 30607007		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28050343	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22728329, 24338765, 30387805, 30877036		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	35170141	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16772787, 19075230, 25134663, 25683705, 26434583, 28068324, 29933193, 30649085		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	16094359, 25157968		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19075230, 20421047, 24338765, 24760019, 26158514, 27878243, 28548936, 28837154, 29023587, 29258530, 29484395, 30649085, 34919787, 35544729	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36156852	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21325635, 26313366		★☆☆☆☆ Found in Text Mining only
Congenital hemihypertrophy	Congenital Hemihypertrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27878305		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28272306		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	31499127		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	37567009	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29435116		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15166380, 21518566		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11782951, 15166380, 21518566, 31835296		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15010337, 15166380, 31835296, 34360895	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	15166380		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28341696, 28931550, 29141982, 29439679, 32596376, 36409629, 37680885	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28132765		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	UNIPROT_DG	15166380, 19164855		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GENOMICS_ENGLAND_DG	15166380, 17327441, 17576055		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17327441, 21518566, 24039187, 28477532, 29301787, 29696964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dissecting aortic aneurysm	Dissecting Aortic Aneurysm	BEFREE	23250987		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	15716609	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27658743, 28541532		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	28541532	Associate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	26374646		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18615621, 21618512, 23174537, 26626801		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18615621, 20218740, 22146979, 30442683	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26512921		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31208717		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	10908564, 26828791	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31208717		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26828791	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	14636889		★☆☆☆☆ Found in Text Mining only
Familial partial lipodystrophy	Partial Lipodystrophy	CTD_human_DG	19793595		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Partial Lipodystrophy, Type 1	Partial Lipodystrophy	CTD_human_DG	19793595		★☆☆☆☆ Found in Text Mining only
Familial Partial Lipodystrophy, Type 2	Partial Lipodystrophy	CTD_human_DG	19793595		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Partial Lipodystrophy, Type 3	Partial Lipodystrophy	CTD_human_DG	19793595		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28541532, 30345259, 30562559		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	30345259	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	27748285		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	15455398		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	15455398		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	26803515		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	26803515	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	36906972	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16707477		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	27469332	Associate	★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	21325635		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	21325635		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15782140, 19861406, 19901546, 20164239, 22771706, 24838891, 27422127, 28576488, 31375748, 9799739		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19861406, 20164239, 24838891	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19861406, 19901546, 22771706, 24838891, 25304263, 27422127, 28576488, 31375748, 9799739		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15557754, 19861406, 20116920, 20514445, 21636708, 22771706, 28979807		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15557754, 16402276		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19861406, 20167810, 27422127, 33369441	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27852048	Inhibit	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	30444896		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	30598523		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type V	Glycogen Storage Disease	BEFREE	30461220		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	17481480	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	36906972	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	30598523		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12697749	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	15010337		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	24061149, 30519800		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	11162573, 21241768, 22275470, 29484683		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	30345259	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25416384, 29120957		★☆☆☆☆ Found in Text Mining only
HYPERTRICHOSIS, CONGENITAL GENERALIZED	HYPERTRICHOSIS	BEFREE	16102584		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	19164855	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy of tonsils	Hypertrophy Of Tonsils	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	21979934, 24285683, 25550458, 26003998, 28541532		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	Pubtator	21979934, 22729222, 28541532	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemic coma	Hypoglycemic coma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoglycemic seizures	Hypoglycemic seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	Pubtator	26622051	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoinsulinemic hypoglycemia and body hemihypertrophy	Hypoinsulinemic Hypoglycemia And Hemihypertrophy	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HYPOINSULINEMIC HYPOGLYCEMIA WITH HEMIHYPERTROPHY	Hypoinsulinemic Hypoglycemia And Hemihypertrophy	GENOMICS_ENGLAND_DG	15166380, 17327441, 24285683, 28502730		★☆☆☆☆ Found in Text Mining only
HYPOINSULINEMIC HYPOGLYCEMIA WITH HEMIHYPERTROPHY	Hypoinsulinemic Hypoglycemia And Hemihypertrophy	ORPHANET_DG	21979934, 24285683		★☆☆☆☆ Found in Text Mining only
HYPOINSULINEMIC HYPOGLYCEMIA WITH HEMIHYPERTROPHY	Hypoinsulinemic Hypoglycemia And Hemihypertrophy	UNIPROT_DG	21979934		★☆☆☆☆ Found in Text Mining only
HYPOINSULINEMIC HYPOGLYCEMIA WITH HEMIHYPERTROPHY	Hypoinsulinemic Hypoglycemia And Hemihypertrophy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
HYPOINSULINEMIC HYPOGLYCEMIA WITH HEMIHYPERTROPHY	Hypoinsulinemic Hypoglycemia And Hemihypertrophy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28455433		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	15166380, 17327441, 19763090, 27516476, 29484683, 36409629	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17986714	Stimulate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22403297	Inhibit	★☆☆☆☆ Found in Text Mining only
Insulin-resistant diabetes mellitus	Insulin-resistant diabetes mellitus	BEFREE	17327441		★☆☆☆☆ Found in Text Mining only
Insulin-resistant diabetes mellitus	Insulin-resistant diabetes mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	21590431		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	28685447		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	36771423	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29056104		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	16409151, 16722806, 17327441		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	17327441	Associate	★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	24321521		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11261840, 12361705, 24247267, 24337067, 24970808, 25424347, 26352279, 28557977, 28586057, 30784932, 31062368, 31802908		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14654898		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27458792	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12361705		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20354455, 24819169, 25855050, 26645682, 29470540, 36203195	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	26654940, 29470540		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25855050	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18316591, 19530243, 7657393, 8646732		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15735908, 16402276, 20116920, 20167810, 20514445, 25737557		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11507039, 12032855, 12244303, 12569575, 14680486, 14681726, 17332325, 21203579, 21297943, 22809628, 23499909, 24838891, 25520137, 27175587, 28287129, 28853539, 29667444, 31357505, 31752925, 7657393		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19075277		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	18615621, 21618512, 26626801		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31208717		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	26803515		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20354455, 21182834, 21387307, 24659658, 26234648, 26654940		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12144681, 12499249, 1409633, 25894377, 29374601, 7657393, 8646743, 9916799		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10490823, 15837735, 15987444, 18949011, 22312312, 27840954, 28534950, 8622988, 8780719, 9496907		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18336616, 21932427, 22020565, 22552290, 22809628, 22815832, 24838891, 26847233, 29207197, 30565691		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20428959, 25428377, 25771729, 29782828		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21836020, 27906180		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11882383, 12144681, 15641016, 16288295, 17804734, 17825284, 18353613, 19216065, 19433066, 19925030, 20167810, 20214616, 20409325, 21297943, 24039187, 24557434, 24659658, 25428377, 25771729, 26741489, 28379898, 28659828, 29017516, 29667444, 29962093, 30598523, 30643008, 31608140, 31781306		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30536701		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16772787, 22728329, 24338765, 30387805, 30877036		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19075277		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15987444, 17332325		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19075277		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19075277		★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	29439679		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11828257, 19843246		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35216449, 37931033	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	17327441, 29202451		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	LHGDN	17327441		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	21979934	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	30345259	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17576055, 18802016, 23147115, 30345259		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	24816239		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	18635812	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24816239, 27919956		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24816239	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21924492	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29383164		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28272306		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31217849		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	CTD_human_DG	24952746		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30582216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neonatal hypoglycemia	Hypoglycemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10593857, 10972292, 11123866, 12032855, 12144681, 12517798, 15543611, 15677629, 15735908, 16102584, 16721043, 16772787, 17804734, 18336616, 18949011, 19843246, 19901546, 20116920, 21297943, 21502955, 21555366, 22475322, 24247267, 24321521, 25304263, 25733895, 25737557, 25771729, 25855050, 25856297, 26102366, 26234648, 26803515, 27059323, 27175587, 27533079, 27716613, 28287129, 28379898, 28476657, 28534950, 28852916, 28853539, 29075783, 29175105, 29391600, 29435076, 29933193, 29962093, 30008879, 30784932, 30942957, 31357505, 7657393, 8646732, 9190895, 9496907, 9799739		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	27871477		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	24321521		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20409325, 23468863, 23900341, 31608140		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	20409325, 23900341, 35018218	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30611996		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	19815051		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28987868		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20354455, 24946858, 26490682, 29075783, 29789623, 30008879		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CLINVAR_DG	21479466, 25157968		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	15010337, 19763090, 31835296	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27307439, 28102348, 30071535, 31835296		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21686164, 26229955, 28289332, 29051585		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	21686164, 26229955	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	8646743		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	BEFREE	22275470		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12144681, 12499249, 16721043, 25894377, 29374601, 9916799		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	14612499, 18842333		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	1409633, 15987444, 16721043, 21979951, 22556379, 25733895, 25894377, 30392041	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18949011, 22312312, 27840954, 28534950, 8780719, 9496907		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17895832, 22312312, 9496907		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	14735903		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	22312312		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25502777, 27840954	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29050238, 30609134		★☆☆☆☆ Found in Text Mining only
Partial lipodystrophy	Partial Lipodystrophy	GENOMICS_ENGLAND_DG	17327441		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	35170141	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	18768676, 22275470		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	18768676, 34044676	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	26491227	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18336616, 21932427, 22020565, 22552290, 22809628, 22815832, 24838891, 26847233, 29207197		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	30295140	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12482965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16721361, 22809628, 22815832, 24838891, 32415173	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	24838891		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28455433		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27878305, 31002126		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25148525, 28714020		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30541951		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33707617	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20214684		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	19075230		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	11752813		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	22748472, 30793508		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30793508	Associate	★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	24321521		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17804734, 19628421		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17804734		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26828791		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33398370	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31100640, 31737186		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23147115, 28541532, 30345259, 30562559		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20428959, 25428377, 25771729, 29782828		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25173755	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26539501		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18316591, 21045156		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	28709620		★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Thymus Neoplasms	BEFREE	27197189		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	17481480	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32737449	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30363988		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	15455398		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21836020, 23698120, 26148825, 27906180	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27364926, 33123457, 36652730, 36906972	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	27748285, 29113583		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	33537821	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	34961976	Associate	★☆☆☆☆ Found in Text Mining only