ERG (ETS transcription factor ERG)

Gene

• Entrez ID: 2078
• Gene name: ETS transcription factor ERG
• Gene symbol: ERG
• Synonyms (NCBI Gene): LMPHM14, erg-3, p55
• Chromosome: 21
• Chromosome location: 21q22.2
• Summary: This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007094	hsa-miR-145-5p	Luciferase reporter assay	23480797
MIRT016692	hsa-miR-133b	Reporter assay	17344217
MIRT053340	hsa-miR-30a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23728339
MIRT053340	hsa-miR-30a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23728339
MIRT053341	hsa-miR-30b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23728339
MIRT053341	hsa-miR-30b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23728339
MIRT007094	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	27572146
MIRT734449	hsa-miR-223-5p	Luciferase reporter assay, qRT-PCR, Western blotting	32489464
MIRT736886	hsa-miR-362-3p	Luciferase reporter assay, qRT-PCR	31659098
MIRT737355	hsa-miR-200b-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32591615
MIRT968746	hsa-miR-105	CLIP-seq
MIRT968747	hsa-miR-106a	CLIP-seq
MIRT968748	hsa-miR-106b	CLIP-seq
MIRT968749	hsa-miR-130a	CLIP-seq
MIRT968750	hsa-miR-130b	CLIP-seq
MIRT968751	hsa-miR-136	CLIP-seq
MIRT968752	hsa-miR-141	CLIP-seq
MIRT968753	hsa-miR-17	CLIP-seq
MIRT968754	hsa-miR-19a	CLIP-seq
MIRT968755	hsa-miR-19b	CLIP-seq
MIRT968756	hsa-miR-200a	CLIP-seq
MIRT968757	hsa-miR-20a	CLIP-seq
MIRT968758	hsa-miR-20b	CLIP-seq
MIRT968759	hsa-miR-217	CLIP-seq
MIRT968760	hsa-miR-301a	CLIP-seq
MIRT968761	hsa-miR-301b	CLIP-seq
MIRT968762	hsa-miR-3166	CLIP-seq
MIRT968763	hsa-miR-3657	CLIP-seq
MIRT968764	hsa-miR-3666	CLIP-seq
MIRT968765	hsa-miR-4279	CLIP-seq
MIRT968766	hsa-miR-4295	CLIP-seq
MIRT968767	hsa-miR-4307	CLIP-seq
MIRT968768	hsa-miR-4503	CLIP-seq
MIRT968769	hsa-miR-454	CLIP-seq
MIRT968770	hsa-miR-4669	CLIP-seq
MIRT968771	hsa-miR-4771	CLIP-seq
MIRT968772	hsa-miR-486-5p	CLIP-seq
MIRT968773	hsa-miR-515-5p	CLIP-seq
MIRT968774	hsa-miR-519a	CLIP-seq
MIRT968775	hsa-miR-519b-3p	CLIP-seq
MIRT968776	hsa-miR-519c-3p	CLIP-seq
MIRT968777	hsa-miR-519d	CLIP-seq
MIRT968778	hsa-miR-548t	CLIP-seq
MIRT968779	hsa-miR-568	CLIP-seq
MIRT968780	hsa-miR-629	CLIP-seq
MIRT968781	hsa-miR-885-5p	CLIP-seq
MIRT968782	hsa-miR-891b	CLIP-seq
MIRT968783	hsa-miR-93	CLIP-seq
MIRT968784	hsa-miR-137	CLIP-seq
MIRT968785	hsa-miR-1237	CLIP-seq
MIRT968786	hsa-miR-1248	CLIP-seq
MIRT968787	hsa-miR-1253	CLIP-seq
MIRT968788	hsa-miR-1256	CLIP-seq
MIRT968789	hsa-miR-1258	CLIP-seq
MIRT968790	hsa-miR-1273e	CLIP-seq
MIRT968791	hsa-miR-1279	CLIP-seq
MIRT968752	hsa-miR-141	CLIP-seq
MIRT968792	hsa-miR-1915	CLIP-seq
MIRT968756	hsa-miR-200a	CLIP-seq
MIRT968759	hsa-miR-217	CLIP-seq
MIRT968793	hsa-miR-30a	CLIP-seq
MIRT968794	hsa-miR-30b	CLIP-seq
MIRT968795	hsa-miR-30c	CLIP-seq
MIRT968796	hsa-miR-30d	CLIP-seq
MIRT968797	hsa-miR-30e	CLIP-seq
MIRT968798	hsa-miR-3124-3p	CLIP-seq
MIRT968799	hsa-miR-3129-3p	CLIP-seq
MIRT968800	hsa-miR-340	CLIP-seq
MIRT968801	hsa-miR-3662	CLIP-seq
MIRT968802	hsa-miR-3663-5p	CLIP-seq
MIRT968803	hsa-miR-3978	CLIP-seq
MIRT968804	hsa-miR-4261	CLIP-seq
MIRT968765	hsa-miR-4279	CLIP-seq
MIRT968805	hsa-miR-4297	CLIP-seq
MIRT968806	hsa-miR-4317	CLIP-seq
MIRT968807	hsa-miR-4424	CLIP-seq
MIRT968768	hsa-miR-4503	CLIP-seq
MIRT968808	hsa-miR-4511	CLIP-seq
MIRT968809	hsa-miR-4528	CLIP-seq
MIRT968810	hsa-miR-4698	CLIP-seq
MIRT968811	hsa-miR-4726-3p	CLIP-seq
MIRT968812	hsa-miR-4797-5p	CLIP-seq
MIRT968813	hsa-miR-548b-3p	CLIP-seq
MIRT968814	hsa-miR-553	CLIP-seq
MIRT968815	hsa-miR-567	CLIP-seq
MIRT968816	hsa-miR-571	CLIP-seq
MIRT968817	hsa-miR-580	CLIP-seq
MIRT968780	hsa-miR-629	CLIP-seq
MIRT968818	hsa-miR-1200	CLIP-seq
MIRT968790	hsa-miR-1273e	CLIP-seq
MIRT968751	hsa-miR-136	CLIP-seq
MIRT968819	hsa-miR-4289	CLIP-seq
MIRT968806	hsa-miR-4317	CLIP-seq
MIRT968820	hsa-miR-4324	CLIP-seq
MIRT968821	hsa-miR-4672	CLIP-seq
MIRT968822	hsa-miR-544b	CLIP-seq
MIRT968792	hsa-miR-1915	CLIP-seq
MIRT1987127	hsa-miR-3130-3p	CLIP-seq
MIRT1987128	hsa-miR-3607-3p	CLIP-seq
MIRT968801	hsa-miR-3662	CLIP-seq
MIRT1987129	hsa-miR-3686	CLIP-seq
MIRT1987130	hsa-miR-370	CLIP-seq
MIRT968803	hsa-miR-3978	CLIP-seq
MIRT968805	hsa-miR-4297	CLIP-seq
MIRT1987131	hsa-miR-4652-3p	CLIP-seq
MIRT968810	hsa-miR-4698	CLIP-seq
MIRT968811	hsa-miR-4726-3p	CLIP-seq
MIRT1987132	hsa-miR-4776-3p	CLIP-seq
MIRT968816	hsa-miR-571	CLIP-seq
MIRT1987133	hsa-miR-626	CLIP-seq
MIRT968747	hsa-miR-106a	CLIP-seq
MIRT968748	hsa-miR-106b	CLIP-seq
MIRT968785	hsa-miR-1237	CLIP-seq
MIRT968786	hsa-miR-1248	CLIP-seq
MIRT968753	hsa-miR-17	CLIP-seq
MIRT968757	hsa-miR-20a	CLIP-seq
MIRT968758	hsa-miR-20b	CLIP-seq
MIRT2221526	hsa-miR-3137	CLIP-seq
MIRT2221527	hsa-miR-3182	CLIP-seq
MIRT1987128	hsa-miR-3607-3p	CLIP-seq
MIRT2221528	hsa-miR-3609	CLIP-seq
MIRT1987129	hsa-miR-3686	CLIP-seq
MIRT2221529	hsa-miR-4432	CLIP-seq
MIRT1987131	hsa-miR-4652-3p	CLIP-seq
MIRT2221530	hsa-miR-4780	CLIP-seq
MIRT2221531	hsa-miR-4796-3p	CLIP-seq
MIRT2221532	hsa-miR-499-5p	CLIP-seq
MIRT968777	hsa-miR-519d	CLIP-seq
MIRT2221533	hsa-miR-539	CLIP-seq
MIRT2221534	hsa-miR-548ah	CLIP-seq
MIRT2221535	hsa-miR-615-5p	CLIP-seq
MIRT2221536	hsa-miR-623	CLIP-seq
MIRT2221537	hsa-miR-758	CLIP-seq
MIRT2221538	hsa-miR-764	CLIP-seq
MIRT968783	hsa-miR-93	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ERG	Activation	21536859
ETS1	Activation	7731694
ETS2	Activation	7731694
FLI1	Activation	21536859
GATA3	Activation	21536859
LMO2	Activation	21536859
LYL1	Activation	21536859
TAL1	Activation	21536859

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	23093599
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	18195090
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	8502479
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	20478527, 21575865, 22531786, 22722839, 27109047
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8502479
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006468	Process	Protein phosphorylation	TAS	8502479
GO:0007165	Process	Signal transduction	TAS	8502479
GO:0030154	Process	Cell differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18195090, 23913826
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18195090, 22235125
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661

Other IDs

• MIM: 165080
• HGNC: 3446
• e!Ensembl: ENSG00000157554

Protein

• UniProt ID: P11308
• Protein name: Transcriptional regulator ERG (Transforming protein ERG)
• Protein function: Transcriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.
• PDB: 1SXE, 4IRG, 4IRH, 4IRI, 5YBC, 5YBD, 6VGE, 6VGG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02198	SAM_PNT	122 → 205	Sterile alpha motif (SAM)/Pointed domain	Domain
  PF00178	Ets	319 → 398	Ets-domain	Domain

• Sequence:

  MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQP
  PARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTT
  NERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLT
  PSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEA
  TQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPYQILGPTS
  SRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNM
  NYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGS
  YHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY

• Sequence length: 479

Pathways

KEGG:

Transcriptional misregulation in cancer
Prostate cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Lymphatic malformation 14	Pathogenic	rs2516996865, rs2517041339, rs1569069402	RCV003405191 RCV003405192 RCV003405216	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute lymphoid leukemia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXTRASKELETAL EWING SARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIALOLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKELETAL EWING SARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	16140924		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	20570349, 20620604, 24504051, 29427188		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16263589, 16954520, 17646667, 20570349, 20620604, 21390130, 2243505, 22869147, 24064621, 24504051, 27494621, 27776115, 28415578		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	21321361, 23380710, 25973911		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	22072540, 27851970		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	19822134		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	19822134		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	21544632, 23250622		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	23412561		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16575875		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19151660, 19396168, 19734849, 21040948, 21499236, 21677539, 21743434, 22505341, 23358695, 23664537, 26331372		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	19396168, 19734849, 23664537, 23686669, 27272561, 27913052, 28550496, 28570007, 31732966		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20620604, 22869147, 27776115		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	22072540		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	11462159		★☆☆☆☆ Found in Text Mining only
Albinism, Oculocutaneous	Oculocutaneous albinism	BEFREE	7298260		★☆☆☆☆ Found in Text Mining only
amyloidosis IX	Amyloidosis	Pubtator	21178509, 30300367	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	20478527		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	39604843	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	18711181	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29535371		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31691800, 34930827	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	GWASCAT_DG	27899403		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31680049, 31691800		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	36142762, 39604843	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	18798265, 20478527		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	18059314, 18192214, 24152733, 28681507, 29297274, 34716268, 37740435	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30892142, 31691800		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16947419		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	25972242	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30892142, 31691800		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30892142	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	31691800	Associate	★☆☆☆☆ Found in Text Mining only
Atrophoderma maculatum	Anetoderma	BEFREE	26885695		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	GWASDB_DG	22843504		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26039128		★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	17896315		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	18065961		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	22674214, 24961351		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	36142762	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	10071076		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	31676784		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	31638934		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10959416, 9052761		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24504051	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	36142762	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	17259299, 20585344, 21178489, 24115221, 25808739, 25889691, 26844274, 26988912	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20479932, 27500376, 28186998, 30150711, 34801551, 40141159	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23913826, 28887309	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17032499, 18474293, 19465903, 21814574, 22463702, 22766791, 24469092, 27913052, 30190183, 30656528		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	40042161	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	24175302	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32591615	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	23222491, 25517949	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20636794		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31348324, 32639612, 35624190	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	19465903, 21336263, 21499238	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26492201, 30892142		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30892142	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	25881913	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	20620604, 22869147, 27776115		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	27776115		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	24068373		★☆☆☆☆ Found in Text Mining only
Chorioretinal atrophy	Chorioretinal atrophy	BEFREE	7254777		★☆☆☆☆ Found in Text Mining only
Choroideremia	Choroideremia	BEFREE	8749050		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	26331372	Associate	★☆☆☆☆ Found in Text Mining only
Color Blindness, Blue	Color blindness	BEFREE	3876823		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12898592		★☆☆☆☆ Found in Text Mining only
Cone Dystrophy	Cone Dystrophy	BEFREE	10333111, 15722315, 24370833		★☆☆☆☆ Found in Text Mining only
Cone dystrophy with supernormal rod response	Cone Dystrophy With Supernormal Rod Response	BEFREE	18235024		★☆☆☆☆ Found in Text Mining only
Cone monochromatism	Cone monochromatism	BEFREE	1513061		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	12359607, 24453473		★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	24469092, 37847647, 38477088	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31430493		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	1320571		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	30950098		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	30950098		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic Tumor	BEFREE	15354743, 9344317		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	24517889	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30811545		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30811545		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28804970	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33562405	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	7926295		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28804970		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31237044		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15068237, 15068251, 16140924, 21321361, 23380710, 25749407, 25973911, 28111453, 31206867, 8617511, 9037601		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	15068237		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27134169, 28111453, 9037601	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	19151660, 28699202		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36814242	Associate	★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	28658152, 30334971		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	10523652, 10561219, 11474174, 12557222, 12907633, 16303180, 17431644, 18295659, 19243895, 20473283, 20633768, 22766791, 23706910, 24723486, 24963049, 25441687, 26690869, 27286459, 29898995, 30257034, 31430493, 7530783, 7591257, 7731694, 8076344, 8162068, 8187069, 8625264, 8648380, 8707406, 9071576, 9242212, 9496833, 9646032		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	10209495, 11471459, 12557222, 16157025, 20231617, 21519790, 24293381, 7591257, 7882340, 8577710, 9049824, 9496833, 9646032, 9836070		★☆☆☆☆ Found in Text Mining only
Extra-osseous Ewing`s sarcoma	Extra-Osseous Ewing`s Sarcoma	ORPHANET_DG	11823984		★☆☆☆☆ Found in Text Mining only
Extraskeletal Ewing sarcoma	Extraskeletal Ewing Sarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eye Diseases, Hereditary	Eye Diseases	BEFREE	1789083		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	17527075, 19029822, 20590547, 20735386, 21178509, 22038307, 22260502, 22300588, 24006850, 24186205, 24435928, 24516518, 24606912, 24870262, 26070514, 26424596, 27271990, 27738792		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	11732005		★☆☆☆☆ Found in Text Mining only
fibroma	Fibroma	BEFREE	29957732		★☆☆☆☆ Found in Text Mining only
Fundus Albipunctatus	Fundus Albipunctatus	BEFREE	15790919		★☆☆☆☆ Found in Text Mining only
Gardner Syndrome	Gardner Syndrome	BEFREE	22300588		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25239601	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	28968266		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	30950098		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31809397		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33040444, 37853449	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	7566386		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	7566386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	30628647	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	22463702		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	21317715, 23774169, 24707153, 30723294, 35440765	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	22463702, 30723294		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23250622, 23380710		★☆☆☆☆ Found in Text Mining only
Histiocytoid hemangioma	Epithelioid hemangioma	BEFREE	29266025		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	12915480		★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	20694842		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1691591		★☆☆☆☆ Found in Text Mining only
Holt-Oram syndrome	Holt-Oram Syndrome	BEFREE	15823919		★☆☆☆☆ Found in Text Mining only
Hyper-IgM Immunodeficiency Syndrome, Type 1	Hyper-IgM Immunodeficiency Syndrome	BEFREE	16019685		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	28591703		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	12531891	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	34987319	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	12531891	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18381358, 35508713	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28248553		★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	10916181, 27486012, 7298260		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	22463702		★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	27776115		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15800067, 23300998, 24068373, 24504051, 26909589, 27055868, 27494621, 28415578, 30630977, 34075404	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	16140924, 19152679, 20570349, 21519790, 23974202, 24504051, 25306899, 27494621, 27776115, 28415578, 31175119, 8187069, 9178886		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	LHGDN	16140924		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	CTD_human_DG	19108891		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid	Myeloid leukemia	Pubtator	10779324	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10354136, 15007164, 19398719, 20026798, 20473283, 20841507, 21317715, 21596848, 21967978, 22983443, 23300998, 24068373, 24867525, 26148230, 26625814, 27055868, 27851970, 28301528, 30150206, 31237044, 34075404, 35083818, 35623083, 35839275, 35899387, 37216686, 38186215, 9242552	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	1835747, 2146981		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10523652, 12907633, 12915480, 15007164, 16275934, 16303180, 17577018, 19781443, 20425451, 20570349, 20694842, 21536242, 21664289, 21967978, 22072540, 22766791, 23327922, 23380710, 23974202, 24068373, 25306899, 25982114, 26148230, 26542308, 26625814, 27604872, 27686867, 27851970, 28301528, 29696374, 31171000, 3274086, 7533529, 7566973, 7731694, 8445947, 9315104		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16275934		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	19822134		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12149223		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	7566973, 9315104		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	10531299, 11741928, 12839862, 14975928, 15072950, 15760896, 16361248, 17965736, 18192214, 18471075, 18551196, 19029296, 19032804, 19668779, 19940115, 21035456, 21057041, 21131594, 21135103, 21881236, 21881254, 22028170, 22149888, 22964610, 23221912, 24152733, 24530480, 26152716, 26526230, 26847485, 27803431, 27998983, 29545312, 29548277, 30628647, 32253972, 32661217, 34357002, 34634443, 38181028, 9765245, 9925876, 9973011	Associate	★☆☆☆☆ Found in Text Mining only
Long Qt Syndrome 2	Long qt syndrome	Pubtator	10531299, 15760896, 19029296, 26847485	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	18927117		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18927117, 21317715	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	1472125		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20018353, 36814242	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	16954520, 17646667, 20570349, 24504051		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31237044		★☆☆☆☆ Found in Text Mining only
Macular dystrophy	Macular dystrophy	BEFREE	11462159		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	30296658		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10959416, 9052761		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	17901709		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20636794		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31491926		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15750627, 16254181, 16585160, 16820092, 16951139, 16951141, 17043636, 17059688, 17079440, 17108102, 17143509, 17172822, 17237811, 17259299, 17334343, 17334351, 17385188, 17390040, 17401460, 17527075, 17637754, 17654723, 17785564, 17922029, 17971772, 17991527, 18065961, 18165275, 18245377, 18245462, 18283340, 18385909, 18451133, 18483239, 18500259, 18519767, 18519769, 18542058, 18676740, 18694509, 18794152, 18798265, 18922926, 18948370, 19029822, 19040532, 19066166, 19136943, 19147579, 19152679, 19156837, 19190343, 19205910, 19293179, 19339269, 19396154, 19396167, 19396168, 19407851, 19409690, 19494719, 19584163, 19584279, 19642730, 19647299, 19649210, 19657377, 19664128, 19716227, 19825963, 19861517, 20014889, 20018353, 20068566, 20104229, 20118910, 20160063, 20303538, 20442300, 20473283, 20478527, 20562851, 20585344, 20590547, 20636794, 20651988, 20687225, 20693979, 20713528, 20735386, 20736744, 20800881, 20814243, 20860828, 20878952, 20947519, 21040948, 21062978, 21088497, 21144642, 21167530, 21169414, 21170267, 21178489, 21178509, 21336263, 21378318, 21385925, 21499236, 21499238, 21519790, 21559405, 21584900, 21600800, 21669963, 21676887, 21707704, 21743434, 21747944, 21773753, 21791629, 21796535, 21802835, 21803613, 21813756, 21937078, 21946329, 22142399, 22202492, 22245323, 22260502, 22300588, 22424448, 22452941, 22463702, 22505341, 22569213, 22642898, 22674191, 22674214, 22695242, 22696228, 22705054, 22736790, 22761906, 22767266, 22821757, 22821767, 22833462, 22849743, 22860005, 22918253, 22930729, 22993300, 23018874, 23045253, 23060067, 23148372, 23196798, 23201468, 23213079, 23267145, 23319146, 23321466, 23334893, 23341502, 23348902, 23352841, 23357671, 23370768, 23381693, 23390522, 23399797, 23410129, 23426182, 23433128, 23447416, 23472063, 23478499, 23480797, 23490727, 23492366, 23535644, 23545904, 23549870, 23555854, 23565244, 23578236, 23615946, 23625457, 23686669, 23701505, 23708657, 23728339, 23746715, 23794398, 23817021, 23843146, 23887154, 23887301, 23892597, 23913826, 23918607, 23918819, 23948277, 23994645, 24006850, 24072184, 24083995, 24098661, 24115221, 24142545, 24149465, 24186205, 24195515, 24204199, 24211598, 24261794, 24266818, 24297949, 24418414, 24435928, 24488012, 24504521, 24510842, 24516518, 24517914, 24563616, 24606912, 24659477, 24753418, 24762546, 24768356, 24777847, 24789172, 24815454, 24909781, 24925673, 24926821, 24931216, 24961351, 24972028, 24985972, 25007053, 25007891, 25043157, 25088707, 25115192, 25175909, 25203299, 25239421, 25252136, 25263440, 25265431, 25266362, 25344575, 25420520, 25630658, 25701228, 25728532, 25754347, 25794974, 25809148, 25889691, 25897494, 25906745, 25933120, 25939480, 25964175, 25972242, 25973080, 25977336, 25990700, 26015065, 26026052, 26030748, 26058078, 26060265, 26070514, 26134445, 26280815, 26282172, 26294063, 26310325, 26339615, 26345389, 26383228, 26392259, 26411452, 26424596, 26459268, 26503111, 26517642, 26575822, 26623558, 26630694, 26711283, 26774207, 26844274, 26857646, 26880803, 26907180, 26959281, 26975494, 26987799, 26988912, 27159573, 27185499, 27191272, 27223260, 27271990, 27272765, 27285981, 27299694, 27320318, 27342909, 27375789, 27377958, 27444279, 27470540, 27470558, 27477529, 27500376, 27562498, 27630329, 27683107, 27753122, 27771128, 27798103, 27803051, 27865106, 27910803, 27913051, 27926866, 28004109, 28055969, 28061466, 28102015, 28123608, 28146062, 28189568, 28344039, 28364793, 28382513, 28419548, 28439080, 28465491, 28467610, 28478327, 28515422, 28520829, 28545426, 28550496, 28560674, 28591703, 28607007, 28659719, 28668826, 28783165, 28805820, 28845585, 28849022, 28854182, 28872154, 28887309, 28929505, 28986382, 29088771, 29167279, 29202479, 29225123, 29304771, 29342271, 29345891, 29346775, 29392925, 29581856, 29712692, 29727181, 29773553, 29786791, 29844131, 29923647, 30009541, 30042415, 30049331, 30051483, 30051493, 30073676, 30078722, 30086793, 30101374, 30108097, 30127371, 30150711, 30165429, 30190183, 30191621, 30195632, 30201302, 30229547, 30241953, 30260630, 30280090, 30291535, 30294801, 30301696, 30430607, 30510458, 30590461, 30623509, 30656528, 30718921, 30733525, 30818754, 30892142, 30900303, 30901730, 30927317, 31043167, 31090082, 31090091, 31111520, 31205559, 31209634, 31210145, 31308362, 31318977, 31359337, 31606028, 31612022, 31614005, 31687881, 31741711, 31745645, 31754047, 31809312, 31826177		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17173048, 18798265, 19396168, 25735316, 27223260, 27783944, 28783165		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17079440, 17527075, 17577018, 17922029, 19029822, 19066166, 19407851, 19938015, 20124490, 20442300, 20562851, 20601956, 20616363, 20651988, 20693982, 20841507, 21170267, 21499238, 21600800, 21747944, 22142399, 22287547, 22300588, 22505341, 22696228, 23052253, 23148372, 23244085, 23348902, 23686669, 23843146, 23887301, 23941784, 23994645, 24006850, 24072184, 24186205, 24504051, 24722062, 24789172, 25175425, 25593303, 25794974, 25925890, 25972242, 26202067, 26542308, 26764246, 26857646, 27328849, 27444279, 27601596, 28146062, 28415558, 28439080, 28550496, 29427004, 29712692, 30138215, 30430607, 30664734, 30679082, 30892142, 31308362, 31612022, 31745645, 8076344		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37217516	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	21317715	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic Dermatofibrosarcoma Protuberans	Metastatic Dermatofibrosarcoma Protuberans	BEFREE	30950098		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18694509, 21937078, 22767266, 23318356, 30051483		★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	7566973		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	28542454		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27913051		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	27386562		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	27386562	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28542454, 29372253, 29372255, 29535371, 30456721		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	23572107		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22488406		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	10779324, 23974202, 7970732, 8187069, 8234289, 9653171		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10071076, 31054182		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	25973911		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	11559860		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	34341114	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10209495, 11823984, 15974803, 16951139, 17334351, 17385188, 17654723, 17991527, 18065961, 18500259, 19066166, 19190343, 19339269, 19396154, 19396168, 19494719, 19649210, 19737655, 19825963, 19938015, 20068566, 20118910, 20473283, 20479932, 20562851, 20585344, 20693982, 21036922, 21062978, 21088497, 21167530, 21178489, 21178509, 21307934, 21378318, 21499238, 21537045, 21773753, 21791629, 21925305, 21937078, 21946329, 22142399, 22313860, 22415461, 22424448, 22431170, 22463702, 22505341, 22705054, 22930729, 23018874, 23148372, 23196798, 23201468, 23204237, 23318356, 23352841, 23370768, 23381693, 23472063, 23480797, 23492366, 23545904, 23558555, 23559350, 23686669, 23701505, 23794398, 23843146, 23941784, 24115221, 24195515, 24510842, 24723486, 24762546, 24789172, 24909781, 24925673, 25007891, 25008066, 25043157, 25056375, 25131421, 25175909, 25232177, 25252136, 25263440, 25266362, 25344575, 25593303, 25728532, 25754347, 25794974, 25906751, 25913390, 25939480, 25964175, 26030748, 26060265, 26134445, 26195723, 26294063, 26310325, 26424596, 26459268, 26575822, 26684029, 26735859, 26752304, 26774207, 26880803, 26959281, 26988912, 27159573, 27191272, 27271990, 27272561, 27320318, 27391263, 27444279, 27500376, 27572146, 27630329, 27771128, 27798103, 27935821, 28055969, 28146062, 28186998, 28344039, 28467610, 28614298, 29088771, 29094395, 29167279, 29427004, 29712692, 29773553, 29844131, 29957732, 30049331, 30101374, 30150711, 30165429, 30191621, 30430607, 30500808, 30586386, 30623509, 30656528, 30679082, 30701334, 30811282, 30818754, 30900303, 30980038, 30993692, 31090082, 31090091, 31186527, 31237044, 31296150, 31376366, 31382165, 31516752, 31638934, 31687881, 31745645, 8387543, 9071576, 9496833		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28508055		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15800067	Associate	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	7591257		★☆☆☆☆ Found in Text Mining only
Night blindness, congenital stationary	Night blindness	BEFREE	11581222, 12044753		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	24510842		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28560674		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	26813971, 28598696, 30900303		★☆☆☆☆ Found in Text Mining only
North Carolina macular dystrophy	North Carolina Macular Dystrophy	BEFREE	16565412		★☆☆☆☆ Found in Text Mining only
Nyctalopia	Nyctalopia	BEFREE	18487375		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	BEFREE	16453125		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24292212, 25852077, 29167279	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27771128, 29167279		★☆☆☆☆ Found in Text Mining only
OCCULT MACULAR DYSTROPHY	OCCULT MACULAR DYSTROPHY	BEFREE	28473427		★☆☆☆☆ Found in Text Mining only
Ocular albinism, type I	Ocular albinism	BEFREE	18798082		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	26624494		★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	29049835		★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30664745		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	GWASCAT_DG	30664745		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	30296658, 31699956, 7933116		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31491926		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	25062690		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22331865, 29755728		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28508055		★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	8617511		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34852650	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	36928819	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	16215946		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16263589, 16954520, 17646667, 20570349, 2243505, 24064621, 24504051, 27494621, 27776115, 28415578		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	27776115		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	20570349, 25306899		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	19147579		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15750627, 16254181, 16820092, 16951139, 16951141, 17059688, 17079440, 17108102, 17143509, 17172822, 17237811, 17334343, 17334351, 17385188, 17390040, 17401460, 17527075, 17637754, 17654723, 17785564, 17971772, 17991527, 18065961, 18165275, 18245377, 18245462, 18283340, 18385909, 18451133, 18483239, 18500259, 18519767, 18519769, 18542058, 18676740, 18694509, 18794152, 18798265, 18948370, 19029822, 19040532, 19136943, 19147579, 19152679, 19156837, 19190343, 19205910, 19293179, 19396154, 19396168, 19407851, 19494719, 19584163, 19584279, 19642730, 19647299, 19649210, 19664128, 19716227, 19734849, 19825963, 19861517, 20018353, 20068566, 20104229, 20118910, 20160063, 20303538, 20442300, 20473283, 20478527, 20562851, 20585344, 20590547, 20651988, 20687225, 20693979, 20713528, 20735386, 20736744, 20800881, 20814243, 20860828, 20878952, 20947519, 21062978, 21088497, 21144642, 21167530, 21169414, 21170267, 21178489, 21178509, 21336263, 21378318, 21385925, 21499236, 21499238, 21519790, 21559405, 21584900, 21600800, 21669963, 21707704, 21743434, 21747944, 21773753, 21791629, 21802835, 21803613, 21937078, 21946329, 22140532, 22142399, 22245323, 22260502, 22300588, 22424448, 22452941, 22463702, 22505341, 22569213, 22642898, 22674214, 22695242, 22696228, 22705054, 22736790, 22767266, 22821757, 22821767, 22860005, 22918253, 22993300, 23018874, 23045253, 23060067, 23148372, 23201468, 23213079, 23267145, 23319146, 23321466, 23334893, 23348902, 23352841, 23357671, 23370768, 23381693, 23399797, 23410129, 23426182, 23433128, 23447416, 23472063, 23478499, 23480797, 23490727, 23492366, 23535644, 23545904, 23549870, 23555854, 23565244, 23578236, 23615946, 23625457, 23653096, 23686669, 23708657, 23728339, 23746715, 23817021, 23850495, 23887154, 23892597, 23913826, 23918607, 23918819, 23948277, 23994645, 24006850, 24072184, 24083995, 24115221, 24142545, 24149465, 24186205, 24195515, 24204199, 24211598, 24266818, 24297949, 24418414, 24435928, 24488012, 24504521, 24516518, 24517914, 24563616, 24606912, 24659477, 24753418, 24762546, 24768356, 24777847, 24789172, 24815454, 24909781, 24925673, 24926821, 24961351, 24972028, 24985972, 25007053, 25007891, 25043157, 25088707, 25115192, 25175909, 25203299, 25239421, 25252136, 25263440, 25265431, 25266362, 25344575, 25630658, 25701228, 25728532, 25754347, 25809148, 25889691, 25897494, 25906745, 25933120, 25939480, 25964175, 25972242, 25973080, 25977336, 25990700, 26015065, 26026052, 26058078, 26060265, 26070514, 26280815, 26282172, 26294063, 26310325, 26339615, 26345389, 26411452, 26424596, 26459268, 26503111, 26517642, 26575822, 26623558, 26630694, 26670747, 26711283, 26774207, 26844274, 26857646, 26907180, 26959281, 26975494, 26987799, 26988912, 27159573, 27191272, 27223260, 27271990, 27272765, 27285981, 27299694, 27320318, 27342909, 27375789, 27377958, 27444279, 27470540, 27470558, 27477529, 27500376, 27562498, 27630329, 27683107, 27753122, 27771128, 27798103, 27865106, 27910803, 27913051, 28004109, 28055969, 28061466, 28102015, 28123608, 28146062, 28189568, 28344039, 28382513, 28419548, 28439080, 28465491, 28467610, 28478327, 28515422, 28520829, 28545426, 28550496, 28560674, 28591703, 28607007, 28659719, 28668826, 28783165, 28805820, 28845585, 28849022, 28854182, 28872154, 28986382, 29088771, 29167279, 29202479, 29225123, 29304771, 29342271, 29345891, 29346775, 29392925, 29712692, 29773553, 29786791, 29844131, 30009541, 30042415, 30049331, 30051483, 30051493, 30073676, 30078722, 30086793, 30101374, 30108097, 30127371, 30150711, 30165429, 30190183, 30191621, 30195632, 30201302, 30229547, 30241953, 30260630, 30280090, 30291535, 30294801, 30301696, 30430607, 30510458, 30590461, 30623509, 30656528, 30718921, 30733525, 30818754, 30892142, 30900303, 30901730, 30927317, 30993692, 31090082, 31090091, 31111520, 31205559, 31209634, 31210145, 31308362, 31318977, 31359337, 31606028, 31612022, 31614005, 31687881, 31741711, 31745645, 31754047, 31826177, 31831298		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	26711283, 27683107, 28102015		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	17032499, 19407851, 20585344, 21499236, 22849743, 23222491, 24297949, 26331372, 27272561, 35508713	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	17922029, 18065961, 18283340, 19396167, 20585344, 21499236, 23887154, 24961351		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	LHGDN	17922029, 18519767		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16820092, 17390040, 17584912, 17632455, 17654723, 18065961, 18483239, 18505969, 18519767, 18519769, 18676740, 18694509, 19156837		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16820092, 17059688, 17079440, 17172822, 17259299, 17334343, 17334351, 17385188, 17401460, 17632455, 17637754, 17971772, 17991527, 18065961, 18165275, 18245462, 18385909, 18483239, 18500259, 18694509, 18711181, 18719366, 18794152, 18948370, 19029822, 19136943, 19156837, 19190343, 19205910, 19293179, 19339269, 19396154, 19407851, 19584163, 19597533, 19647299, 19649210, 19933109, 20018353, 20068566, 20104229, 20118910, 20473283, 20478527, 20516122, 20585344, 20616363, 20693979, 20860828, 20935156, 20947519, 20975660, 21036922, 21088497, 21170267, 21178489, 21178509, 21281786, 21307934, 21378318, 21499236, 21499238, 21600800, 21669963, 21676887, 21680704, 21724842, 21743434, 21814574, 21937078, 21946329, 22076164, 22123976, 22349460, 22531786, 22642898, 22761906, 22849743, 22899295, 22922762, 23086769, 23148372, 23196798, 23244085, 23251544, 23272087, 23318356, 23334893, 23341502, 23348902, 23358695, 23370768, 23381693, 23447416, 23459095, 23480797, 23535644, 23545904, 23555854, 23565244, 23661613, 23686669, 23701505, 23781502, 23887301, 23913826, 23918819, 23941784, 23994645, 24083995, 24098661, 24115221, 24186205, 24292212, 24297949, 24504521, 24515272, 24516518, 24606912, 24762546, 24815454, 24925673, 24972028, 25007891, 25043157, 25056375, 25115192, 25175909, 25201530, 25203299, 25266362, 25344575, 25420520, 25544710, 25639219, 25728532, 25730763, 25753984, 25754347, 25809148, 25852077, 25889691, 25897494, 25906745, 25915538, 25964175, 25972242, 25985884, 26035357, 26172920, 26195723, 26202067, 26280815, 26310325, 26331372, 26344095, 26344096, 26503111, 26575822, 26623558, 26684029, 26743468, 26752304, 26803516, 26817504, 26941365, 26986253, 26988912, 26990456, 27012192, 27049720, 27127882, 27144529, 27159573, 27223260, 27238617, 27271990, 27285981, 27320318, 27375789, 27377958, 27444279, 27470540, 27477529, 27500376, 27530104, 27562498, 27626314, 27738792, 27753122, 27798103, 27906189, 27926866, 28050800, 28102015, 28146062, 28341589, 28415558, 28445989, 28545426, 28547958, 28551819, 28555048, 28607007, 28652740, 28753864, 28753869, 28805820, 28849022, 28887309, 28954787, 29167279, 29181411, 29304771, 29346775, 29949537, 30086793, 30150711, 30165429, 30173226, 30190183, 30301696, 30357756, 30606742, 30656528, 30818754, 30892142, 30901730, 31043167, 31075299, 31090091, 31111520, 31186527, 31318977, 31616062, 31779479, 31826177, 31901908, 31915468, 32229180, 32313185, 32343676, 32387456, 32417965, 32433882, 32573479, 32631746, 32639612, 32646965, 32915889, 33141952, 33230156, 33303959, 33485866, 33509203, 33627383, 33754616, 33771697, 33812851, 33932111, 34341114, 34372976, 34507017, 34717149, 34792282, 35083818, 35163398, 35410344, 35508713, 35513774, 35574900, 35943799, 36125519, 36170835, 36199157, 36329628, 36443337, 36576468, 36622760, 37300660, 37307876, 37310937, 37686146, 37847647, 37956771, 38017230, 38256434, 38477088, 38522124, 39190349, 39741346	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17173048, 18798265, 19396168, 25735316, 27223260, 27783944, 28783165		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	17334351, 18245377, 18676740, 18694509, 19597533, 20479932, 20585344, 21378318, 22505341, 23318356, 23319146, 23321466, 23535644, 23555854, 24098661, 24115221, 24796539, 24931216, 25007053, 25088707, 25753984, 25939480, 26058078, 26310325, 26751641, 26844274, 27191272, 27272765, 27626314, 27753122, 27814612, 28439080, 28598696, 28607007, 28783165, 29786791, 31303963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28419548	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Veno-Occlusive Disease (disorder)	Pulmonary venoocclusive disease	BEFREE	25062690		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31430493		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28243236		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	12471061, 16272055, 24370833, 30608181, 30640972		★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	BEFREE	26893257		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	11559860, 12939320, 14960774, 17325176, 21219898, 23381693, 2356700, 27144529, 28604982, 29189947, 30285522, 3772690, 6700949		★☆☆☆☆ Found in Text Mining only
Retinoschisis, Juvenile, X-Linked	Retinoschisis, X-Linked	BEFREE	16272055, 30025115, 30608181, 31747688		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	17431644		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	24517889	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10088772, 11953970, 1320571		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	3138285		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15974803, 20814243, 22766791, 26735859, 26847175, 28197724, 7731694		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18648544		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	24072183, 26261664, 31645347, 35440765	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	12186432, 12736494, 17620387, 18212050, 18310898, 21317715, 23185447, 23774169, 24517889, 24667836, 24723486, 28643791, 31237044, 32362012, 34009296, 35088879, 37372318, 7524604, 7599072, 8022439, 8223458, 9738976	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	21317715	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	31087789, 31615564		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29745706		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	33562405	Associate	★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	31676784		★☆☆☆☆ Found in Text Mining only
Sinus histiocytosis	Sinus Histiocytosis	BEFREE	31274698		★☆☆☆☆ Found in Text Mining only
Skeletal Ewing sarcoma	Skeletal Ewing Sarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	34987319	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	20636794, 21040948, 21499238, 23850495, 24777847		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	9344317		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29933892		★☆☆☆☆ Found in Text Mining only
STARGARDT DISEASE 1 (disorder)	Stargardt disease	BEFREE	15942264, 24453473, 30285522		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15846098	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37759298	Inhibit	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	BEFREE	12111638		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	31676784		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	31676784		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	23569377	Associate	★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de pointes	Pubtator	18059314, 23812503, 29297274, 31347753	Associate	★☆☆☆☆ Found in Text Mining only
Tricuspid Atresia	Tricuspid atresia	Pubtator	36142762	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28590426	Associate	★☆☆☆☆ Found in Text Mining only
Usher syndrome type 2	Usher Syndrome	BEFREE	30073356		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	36653477	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	24555745		★☆☆☆☆ Found in Text Mining only
X-linked retinitis pigmentosa	Retinitis Pigmentosa, X-Linked	BEFREE	17325176		★☆☆☆☆ Found in Text Mining only