Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	207063
Gene name	Dehydrogenase/reductase X-linked
Gene symbol	DHRSX
Synonyms (NCBI Gene)	CDG1DDCXorf11DHRS5XDHRS5YDHRSXYDHRSYSDR46C1SDR7C6
Chromosome	X\|Y
Chromosome location	Xp22.33 and Yp11.2

Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044469	hsa-miR-320a	CLASH	23622248
MIRT935038	hsa-miR-101	CLIP-seq
MIRT935039	hsa-miR-3653	CLIP-seq
MIRT935040	hsa-miR-3665	CLIP-seq
MIRT935041	hsa-miR-3673	CLIP-seq
MIRT935042	hsa-miR-371-5p	CLIP-seq
MIRT935043	hsa-miR-371b-5p	CLIP-seq
MIRT935044	hsa-miR-4265	CLIP-seq
MIRT935045	hsa-miR-4296	CLIP-seq
MIRT935046	hsa-miR-4313	CLIP-seq
MIRT935047	hsa-miR-4322	CLIP-seq
MIRT935048	hsa-miR-4417	CLIP-seq
MIRT935049	hsa-miR-4422	CLIP-seq
MIRT935050	hsa-miR-4455	CLIP-seq
MIRT935051	hsa-miR-4719	CLIP-seq
MIRT935052	hsa-miR-4736	CLIP-seq
MIRT935053	hsa-miR-513c	CLIP-seq
MIRT935054	hsa-miR-514b-5p	CLIP-seq
MIRT935055	hsa-miR-539	CLIP-seq
MIRT935056	hsa-miR-561	CLIP-seq
MIRT935057	hsa-miR-563	CLIP-seq
MIRT935058	hsa-miR-584	CLIP-seq
MIRT935059	hsa-miR-609	CLIP-seq
MIRT1976890	hsa-miR-3074-5p	CLIP-seq
MIRT1976891	hsa-miR-4793-5p	CLIP-seq
MIRT2212172	hsa-miR-1207-3p	CLIP-seq
MIRT2212173	hsa-miR-1227	CLIP-seq
MIRT2212174	hsa-miR-1285	CLIP-seq
MIRT2212175	hsa-miR-1323	CLIP-seq
MIRT2212176	hsa-miR-134	CLIP-seq
MIRT2212177	hsa-miR-3118	CLIP-seq
MIRT2212178	hsa-miR-3164	CLIP-seq
MIRT2212179	hsa-miR-3187-5p	CLIP-seq
MIRT2212180	hsa-miR-3614-5p	CLIP-seq
MIRT2212181	hsa-miR-361-5p	CLIP-seq
MIRT935041	hsa-miR-3673	CLIP-seq
MIRT935042	hsa-miR-371-5p	CLIP-seq
MIRT935043	hsa-miR-371b-5p	CLIP-seq
MIRT2212182	hsa-miR-548o	CLIP-seq
MIRT2212183	hsa-miR-549	CLIP-seq
MIRT2212184	hsa-miR-612	CLIP-seq
MIRT2212185	hsa-miR-758	CLIP-seq
MIRT2212186	hsa-miR-943	CLIP-seq
MIRT2212175	hsa-miR-1323	CLIP-seq
MIRT2386888	hsa-miR-3125	CLIP-seq
MIRT935042	hsa-miR-371-5p	CLIP-seq
MIRT935043	hsa-miR-371b-5p	CLIP-seq
MIRT2386889	hsa-miR-3916	CLIP-seq
MIRT2212182	hsa-miR-548o	CLIP-seq
MIRT2386890	hsa-miR-877	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	25076851
GO:0005576	Component	Extracellular region	IEA
GO:0005811	Component	Lipid droplet	IDA	38821050
GO:0005811	Component	Lipid droplet	IEA
GO:0010508	Process	Positive regulation of autophagy	IBA
GO:0010508	Process	Positive regulation of autophagy	IMP	25076851
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0043048	Process	Dolichyl monophosphate biosynthetic process	IDA	38821050
GO:0160196	Function	Polyprenol dehydrogenase (NAD+) activity	IDA	38821050
GO:0160196	Function	Polyprenol dehydrogenase (NAD+) activity	IEA
GO:0160197	Function	Dolichal reductase (NADPH) activity	IDA	38821050
GO:0160197	Function	Dolichal reductase (NADPH) activity	IEA

MIM	HGNC	e!Ensembl
301034	18399	ENSG00000169084

Q8N5I4

Protein name

Polyprenol dehydrogenase (EC 1.1.1.441) (DHRSXY) (Dehydrogenase/reductase SDR family member on chromosome X) (Dolichal reductase)

Protein function

Oxidoreductase that plays a key role in early steps of protein N-linked glycosylation by mediating two non-consecutive steps in dolichol biosynthesis (PubMed:38821050). Acts both as a NAD(+)-dependent dehydrogenase and as a NADPH-dependent reduc

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00106	adh_short	44 → 254	short chain dehydrogenase	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly expressed in the pancreas. {ECO:0000269|PubMed:11731500, ECO:0000269|PubMed:25076851}.

Sequence

MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTA
KHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKK
IPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVT
VSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDP
GVVNTDVYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGHYLYNEKET
KSLHVTYNQKLQQQLWSKSCEMTGVLDVTL

Sequence length

330

Interactions

View interactions

	KEGG
	N-Glycan biosynthesis Metabolic pathways

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE 1DD	—	ClinVar, HPO ClinVar, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	36017582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	22365286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36017582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DHRSX (dehydrogenase/reductase X-linked)