EREG (epiregulin)

Gene

• Entrez ID: 2069
• Gene name: Epiregulin
• Gene symbol: EREG
• Synonyms (NCBI Gene): EPR, ER, Ep
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: This gene encodes a secreted peptide hormone and member of the epidermal growth factor (EGF) family of proteins. The encoded protein is a ligand of the epidermal growth factor receptor (EGFR) and the structurally related erb-b2 receptor tyrosine kinase 4

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016703	hsa-miR-335-5p	Microarray	18185580
MIRT022139	hsa-miR-124-3p	Microarray	18668037
MIRT437629	hsa-miR-150-5p	Microarray, qRT-PCR	22815788
MIRT437656	hsa-miR-181a-5p	Microarray, qRT-PCR	22815788
MIRT437753	hsa-miR-93-5p	Microarray, qRT-PCR	22815788
MIRT504837	hsa-miR-302f	PAR-CLIP	23446348
MIRT504836	hsa-miR-186-3p	PAR-CLIP	23446348
MIRT504835	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT437629	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT504834	hsa-miR-532-3p	PAR-CLIP	23446348
MIRT504833	hsa-miR-2116-3p	PAR-CLIP	23446348
MIRT504832	hsa-miR-103a-2-5p	PAR-CLIP	23446348
MIRT504831	hsa-miR-4713-5p	PAR-CLIP	23446348
MIRT504830	hsa-miR-6867-3p	PAR-CLIP	23446348
MIRT504829	hsa-miR-3977	PAR-CLIP	23446348
MIRT504828	hsa-miR-576-5p	PAR-CLIP	23446348
MIRT504827	hsa-miR-629-3p	PAR-CLIP	23446348
MIRT504826	hsa-miR-6885-3p	PAR-CLIP	23446348
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT437753	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT504837	hsa-miR-302f	PAR-CLIP	23446348
MIRT504836	hsa-miR-186-3p	PAR-CLIP	23446348
MIRT504835	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT437629	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT504834	hsa-miR-532-3p	PAR-CLIP	23446348
MIRT504833	hsa-miR-2116-3p	PAR-CLIP	23446348
MIRT504832	hsa-miR-103a-2-5p	PAR-CLIP	23446348
MIRT504831	hsa-miR-4713-5p	PAR-CLIP	23446348
MIRT504830	hsa-miR-6867-3p	PAR-CLIP	23446348
MIRT504829	hsa-miR-3977	PAR-CLIP	23446348
MIRT504828	hsa-miR-576-5p	PAR-CLIP	23446348
MIRT504827	hsa-miR-629-3p	PAR-CLIP	23446348
MIRT504826	hsa-miR-6885-3p	PAR-CLIP	23446348
MIRT968613	hsa-miR-1227	CLIP-seq
MIRT968614	hsa-miR-1285	CLIP-seq
MIRT968615	hsa-miR-1297	CLIP-seq
MIRT968616	hsa-miR-1305	CLIP-seq
MIRT968617	hsa-miR-150	CLIP-seq
MIRT968618	hsa-miR-1827	CLIP-seq
MIRT968619	hsa-miR-2114	CLIP-seq
MIRT968620	hsa-miR-23a	CLIP-seq
MIRT968621	hsa-miR-23b	CLIP-seq
MIRT968622	hsa-miR-23c	CLIP-seq
MIRT968623	hsa-miR-26a	CLIP-seq
MIRT968624	hsa-miR-26b	CLIP-seq
MIRT968625	hsa-miR-3127-3p	CLIP-seq
MIRT968626	hsa-miR-3145-5p	CLIP-seq
MIRT968627	hsa-miR-3187-5p	CLIP-seq
MIRT968628	hsa-miR-323-3p	CLIP-seq
MIRT968629	hsa-miR-3622b-5p	CLIP-seq
MIRT968630	hsa-miR-3664-3p	CLIP-seq
MIRT968631	hsa-miR-3671	CLIP-seq
MIRT968632	hsa-miR-3682-5p	CLIP-seq
MIRT968633	hsa-miR-3929	CLIP-seq
MIRT968634	hsa-miR-3945	CLIP-seq
MIRT968635	hsa-miR-4252	CLIP-seq
MIRT968636	hsa-miR-4253	CLIP-seq
MIRT968637	hsa-miR-4419b	CLIP-seq
MIRT968638	hsa-miR-4433	CLIP-seq
MIRT968639	hsa-miR-4459	CLIP-seq
MIRT968640	hsa-miR-4465	CLIP-seq
MIRT968641	hsa-miR-4477b	CLIP-seq
MIRT968642	hsa-miR-4478	CLIP-seq
MIRT968643	hsa-miR-4649-3p	CLIP-seq
MIRT968644	hsa-miR-4695-5p	CLIP-seq
MIRT968645	hsa-miR-4768-3p	CLIP-seq
MIRT968646	hsa-miR-4787-3p	CLIP-seq
MIRT968647	hsa-miR-4793-3p	CLIP-seq
MIRT968648	hsa-miR-485-5p	CLIP-seq
MIRT968649	hsa-miR-486-5p	CLIP-seq
MIRT968650	hsa-miR-490-3p	CLIP-seq
MIRT968651	hsa-miR-498	CLIP-seq
MIRT968652	hsa-miR-548c-3p	CLIP-seq
MIRT968653	hsa-miR-590-3p	CLIP-seq
MIRT968654	hsa-miR-607	CLIP-seq
MIRT968655	hsa-miR-612	CLIP-seq
MIRT968656	hsa-miR-656	CLIP-seq
MIRT968657	hsa-miR-767-3p	CLIP-seq
MIRT968658	hsa-miR-940	CLIP-seq
MIRT968614	hsa-miR-1285	CLIP-seq
MIRT968627	hsa-miR-3187-5p	CLIP-seq
MIRT968655	hsa-miR-612	CLIP-seq
MIRT1921210	hsa-miR-4477a	CLIP-seq
MIRT1921211	hsa-miR-4795-3p	CLIP-seq
MIRT1921212	hsa-miR-4803	CLIP-seq
MIRT968656	hsa-miR-656	CLIP-seq
MIRT968613	hsa-miR-1227	CLIP-seq
MIRT968614	hsa-miR-1285	CLIP-seq
MIRT1987095	hsa-miR-1294	CLIP-seq
MIRT968616	hsa-miR-1305	CLIP-seq
MIRT968618	hsa-miR-1827	CLIP-seq
MIRT968626	hsa-miR-3145-5p	CLIP-seq
MIRT968627	hsa-miR-3187-5p	CLIP-seq
MIRT968630	hsa-miR-3664-3p	CLIP-seq
MIRT968633	hsa-miR-3929	CLIP-seq
MIRT1987096	hsa-miR-410	CLIP-seq
MIRT968635	hsa-miR-4252	CLIP-seq
MIRT968637	hsa-miR-4419b	CLIP-seq
MIRT968638	hsa-miR-4433	CLIP-seq
MIRT968639	hsa-miR-4459	CLIP-seq
MIRT968642	hsa-miR-4478	CLIP-seq
MIRT1987097	hsa-miR-4537	CLIP-seq
MIRT968643	hsa-miR-4649-3p	CLIP-seq
MIRT968644	hsa-miR-4695-5p	CLIP-seq
MIRT1987098	hsa-miR-4722-5p	CLIP-seq
MIRT968645	hsa-miR-4768-3p	CLIP-seq
MIRT968647	hsa-miR-4793-3p	CLIP-seq
MIRT968648	hsa-miR-485-5p	CLIP-seq
MIRT968650	hsa-miR-490-3p	CLIP-seq
MIRT968655	hsa-miR-612	CLIP-seq
MIRT968658	hsa-miR-940	CLIP-seq
MIRT968613	hsa-miR-1227	CLIP-seq
MIRT968614	hsa-miR-1285	CLIP-seq
MIRT2221495	hsa-miR-181a	CLIP-seq
MIRT2221496	hsa-miR-181b	CLIP-seq
MIRT2221497	hsa-miR-181c	CLIP-seq
MIRT2221498	hsa-miR-181d	CLIP-seq
MIRT968618	hsa-miR-1827	CLIP-seq
MIRT2221499	hsa-miR-1915	CLIP-seq
MIRT968619	hsa-miR-2114	CLIP-seq
MIRT968626	hsa-miR-3145-5p	CLIP-seq
MIRT968627	hsa-miR-3187-5p	CLIP-seq
MIRT2221500	hsa-miR-3190	CLIP-seq
MIRT968630	hsa-miR-3664-3p	CLIP-seq
MIRT968631	hsa-miR-3671	CLIP-seq
MIRT968633	hsa-miR-3929	CLIP-seq
MIRT968635	hsa-miR-4252	CLIP-seq
MIRT2221501	hsa-miR-4262	CLIP-seq
MIRT968637	hsa-miR-4419b	CLIP-seq
MIRT968638	hsa-miR-4433	CLIP-seq
MIRT968639	hsa-miR-4459	CLIP-seq
MIRT968642	hsa-miR-4478	CLIP-seq
MIRT2221502	hsa-miR-4491	CLIP-seq
MIRT2221503	hsa-miR-452	CLIP-seq
MIRT968643	hsa-miR-4649-3p	CLIP-seq
MIRT2221504	hsa-miR-4657	CLIP-seq
MIRT2221505	hsa-miR-4676-3p	CLIP-seq
MIRT968644	hsa-miR-4695-5p	CLIP-seq
MIRT1987098	hsa-miR-4722-5p	CLIP-seq
MIRT968645	hsa-miR-4768-3p	CLIP-seq
MIRT968647	hsa-miR-4793-3p	CLIP-seq
MIRT968648	hsa-miR-485-5p	CLIP-seq
MIRT968650	hsa-miR-490-3p	CLIP-seq
MIRT2221506	hsa-miR-548n	CLIP-seq
MIRT2221507	hsa-miR-563	CLIP-seq
MIRT2221508	hsa-miR-576-3p	CLIP-seq
MIRT968655	hsa-miR-612	CLIP-seq
MIRT968657	hsa-miR-767-3p	CLIP-seq
MIRT968658	hsa-miR-940	CLIP-seq
MIRT968618	hsa-miR-1827	CLIP-seq
MIRT968633	hsa-miR-3929	CLIP-seq
MIRT968637	hsa-miR-4419b	CLIP-seq
MIRT968638	hsa-miR-4433	CLIP-seq
MIRT968639	hsa-miR-4459	CLIP-seq
MIRT968642	hsa-miR-4478	CLIP-seq
MIRT2387519	hsa-miR-4635	CLIP-seq
MIRT968643	hsa-miR-4649-3p	CLIP-seq
MIRT968644	hsa-miR-4695-5p	CLIP-seq
MIRT1987098	hsa-miR-4722-5p	CLIP-seq
MIRT2387520	hsa-miR-4753-3p	CLIP-seq
MIRT968645	hsa-miR-4768-3p	CLIP-seq
MIRT2387521	hsa-miR-4768-5p	CLIP-seq
MIRT968648	hsa-miR-485-5p	CLIP-seq
MIRT968658	hsa-miR-940	CLIP-seq
MIRT2437035	hsa-miR-1224-5p	CLIP-seq
MIRT2437036	hsa-miR-127-5p	CLIP-seq
MIRT2437037	hsa-miR-1277	CLIP-seq
MIRT2437038	hsa-miR-1304	CLIP-seq
MIRT2437039	hsa-miR-135a	CLIP-seq
MIRT2437040	hsa-miR-135b	CLIP-seq
MIRT2437041	hsa-miR-141	CLIP-seq
MIRT968617	hsa-miR-150	CLIP-seq
MIRT2221495	hsa-miR-181a	CLIP-seq
MIRT2221496	hsa-miR-181b	CLIP-seq
MIRT2221497	hsa-miR-181c	CLIP-seq
MIRT2221498	hsa-miR-181d	CLIP-seq
MIRT2221499	hsa-miR-1915	CLIP-seq
MIRT2437042	hsa-miR-200a	CLIP-seq
MIRT2437043	hsa-miR-219-1-3p	CLIP-seq
MIRT2437044	hsa-miR-2355-5p	CLIP-seq
MIRT2437045	hsa-miR-3125	CLIP-seq
MIRT2437046	hsa-miR-3157-5p	CLIP-seq
MIRT2437047	hsa-miR-3163	CLIP-seq
MIRT2437048	hsa-miR-33a	CLIP-seq
MIRT2437049	hsa-miR-33b	CLIP-seq
MIRT2437050	hsa-miR-34c-3p	CLIP-seq
MIRT2437051	hsa-miR-3661	CLIP-seq
MIRT2437052	hsa-miR-3662	CLIP-seq
MIRT968630	hsa-miR-3664-3p	CLIP-seq
MIRT968631	hsa-miR-3671	CLIP-seq
MIRT968632	hsa-miR-3682-5p	CLIP-seq
MIRT2437053	hsa-miR-376a	CLIP-seq
MIRT2437054	hsa-miR-376b	CLIP-seq
MIRT2437055	hsa-miR-3907	CLIP-seq
MIRT2437056	hsa-miR-3915	CLIP-seq
MIRT2437057	hsa-miR-3916	CLIP-seq
MIRT2437058	hsa-miR-3928	CLIP-seq
MIRT2437059	hsa-miR-4257	CLIP-seq
MIRT2221501	hsa-miR-4262	CLIP-seq
MIRT2437060	hsa-miR-4420	CLIP-seq
MIRT2437061	hsa-miR-4453	CLIP-seq
MIRT1921210	hsa-miR-4477a	CLIP-seq
MIRT2437062	hsa-miR-4538	CLIP-seq
MIRT2437063	hsa-miR-4633-5p	CLIP-seq
MIRT2437064	hsa-miR-4639-5p	CLIP-seq
MIRT2437065	hsa-miR-4646-5p	CLIP-seq
MIRT2437066	hsa-miR-4666-3p	CLIP-seq
MIRT2437067	hsa-miR-4668-3p	CLIP-seq
MIRT2437068	hsa-miR-4689	CLIP-seq
MIRT2437069	hsa-miR-4691-3p	CLIP-seq
MIRT2437070	hsa-miR-4700-3p	CLIP-seq
MIRT2437071	hsa-miR-4709-3p	CLIP-seq
MIRT2437072	hsa-miR-4755-3p	CLIP-seq
MIRT2437073	hsa-miR-4765	CLIP-seq
MIRT1921211	hsa-miR-4795-3p	CLIP-seq
MIRT1921212	hsa-miR-4803	CLIP-seq
MIRT2437074	hsa-miR-520a-5p	CLIP-seq
MIRT2437075	hsa-miR-525-5p	CLIP-seq
MIRT2437076	hsa-miR-526b	CLIP-seq
MIRT2437077	hsa-miR-532-5p	CLIP-seq
MIRT2437078	hsa-miR-543	CLIP-seq
MIRT2437079	hsa-miR-548q	CLIP-seq
MIRT2437080	hsa-miR-610	CLIP-seq
MIRT2437081	hsa-miR-631	CLIP-seq
MIRT968656	hsa-miR-656	CLIP-seq
MIRT2437082	hsa-miR-873	CLIP-seq
MIRT2437083	hsa-miR-877	CLIP-seq
MIRT1921210	hsa-miR-4477a	CLIP-seq
MIRT1921211	hsa-miR-4795-3p	CLIP-seq
MIRT1921212	hsa-miR-4803	CLIP-seq
MIRT968656	hsa-miR-656	CLIP-seq
MIRT2448934	hsa-miR-1267	CLIP-seq
MIRT968614	hsa-miR-1285	CLIP-seq
MIRT968619	hsa-miR-2114	CLIP-seq
MIRT968627	hsa-miR-3187-5p	CLIP-seq
MIRT968629	hsa-miR-3622b-5p	CLIP-seq
MIRT968630	hsa-miR-3664-3p	CLIP-seq
MIRT968633	hsa-miR-3929	CLIP-seq
MIRT2448935	hsa-miR-3942-5p	CLIP-seq
MIRT968634	hsa-miR-3945	CLIP-seq
MIRT968636	hsa-miR-4253	CLIP-seq
MIRT968637	hsa-miR-4419b	CLIP-seq
MIRT968638	hsa-miR-4433	CLIP-seq
MIRT968639	hsa-miR-4459	CLIP-seq
MIRT968642	hsa-miR-4478	CLIP-seq
MIRT968644	hsa-miR-4695-5p	CLIP-seq
MIRT2448936	hsa-miR-4703-5p	CLIP-seq
MIRT968645	hsa-miR-4768-3p	CLIP-seq
MIRT2448937	hsa-miR-4777-3p	CLIP-seq
MIRT968646	hsa-miR-4787-3p	CLIP-seq
MIRT968648	hsa-miR-485-5p	CLIP-seq
MIRT968652	hsa-miR-548c-3p	CLIP-seq
MIRT968655	hsa-miR-612	CLIP-seq
MIRT968657	hsa-miR-767-3p	CLIP-seq
MIRT968614	hsa-miR-1285	CLIP-seq
MIRT968627	hsa-miR-3187-5p	CLIP-seq
MIRT968652	hsa-miR-548c-3p	CLIP-seq
MIRT968655	hsa-miR-612	CLIP-seq
MIRT2437035	hsa-miR-1224-5p	CLIP-seq
MIRT2525114	hsa-miR-1228	CLIP-seq
MIRT2525115	hsa-miR-1246	CLIP-seq
MIRT2525116	hsa-miR-1258	CLIP-seq
MIRT2525117	hsa-miR-125a-5p	CLIP-seq
MIRT2525118	hsa-miR-125b	CLIP-seq
MIRT2437037	hsa-miR-1277	CLIP-seq
MIRT968614	hsa-miR-1285	CLIP-seq
MIRT2525119	hsa-miR-1301	CLIP-seq
MIRT2437038	hsa-miR-1304	CLIP-seq
MIRT2437039	hsa-miR-135a	CLIP-seq
MIRT2437040	hsa-miR-135b	CLIP-seq
MIRT968617	hsa-miR-150	CLIP-seq
MIRT2221495	hsa-miR-181a	CLIP-seq
MIRT2221496	hsa-miR-181b	CLIP-seq
MIRT2221497	hsa-miR-181c	CLIP-seq
MIRT2221498	hsa-miR-181d	CLIP-seq
MIRT968618	hsa-miR-1827	CLIP-seq
MIRT2525120	hsa-miR-1913	CLIP-seq
MIRT968619	hsa-miR-2114	CLIP-seq
MIRT2437043	hsa-miR-219-1-3p	CLIP-seq
MIRT2525121	hsa-miR-3121-3p	CLIP-seq
MIRT2525122	hsa-miR-3122	CLIP-seq
MIRT2437045	hsa-miR-3125	CLIP-seq
MIRT968626	hsa-miR-3145-5p	CLIP-seq
MIRT2437046	hsa-miR-3157-5p	CLIP-seq
MIRT2525123	hsa-miR-3165	CLIP-seq
MIRT968627	hsa-miR-3187-5p	CLIP-seq
MIRT2525124	hsa-miR-324-3p	CLIP-seq
MIRT2525125	hsa-miR-325	CLIP-seq
MIRT2437048	hsa-miR-33a	CLIP-seq
MIRT2437049	hsa-miR-33b	CLIP-seq
MIRT2437050	hsa-miR-34c-3p	CLIP-seq
MIRT2525126	hsa-miR-3613-3p	CLIP-seq
MIRT968629	hsa-miR-3622b-5p	CLIP-seq
MIRT2525127	hsa-miR-3647-3p	CLIP-seq
MIRT2437051	hsa-miR-3661	CLIP-seq
MIRT968630	hsa-miR-3664-3p	CLIP-seq
MIRT968631	hsa-miR-3671	CLIP-seq
MIRT2525128	hsa-miR-3672	CLIP-seq
MIRT968632	hsa-miR-3682-5p	CLIP-seq
MIRT2525129	hsa-miR-3689a-3p	CLIP-seq
MIRT2525130	hsa-miR-3689c	CLIP-seq
MIRT2525131	hsa-miR-3689d	CLIP-seq
MIRT2525132	hsa-miR-371-5p	CLIP-seq
MIRT2525133	hsa-miR-371b-5p	CLIP-seq
MIRT2437053	hsa-miR-376a	CLIP-seq
MIRT2437054	hsa-miR-376b	CLIP-seq
MIRT2437055	hsa-miR-3907	CLIP-seq
MIRT2525134	hsa-miR-3913-5p	CLIP-seq
MIRT2437056	hsa-miR-3915	CLIP-seq
MIRT2437057	hsa-miR-3916	CLIP-seq
MIRT2525135	hsa-miR-3926	CLIP-seq
MIRT2437058	hsa-miR-3928	CLIP-seq
MIRT968633	hsa-miR-3929	CLIP-seq
MIRT968634	hsa-miR-3945	CLIP-seq
MIRT1987096	hsa-miR-410	CLIP-seq
MIRT968635	hsa-miR-4252	CLIP-seq
MIRT968636	hsa-miR-4253	CLIP-seq
MIRT2437059	hsa-miR-4257	CLIP-seq
MIRT2221501	hsa-miR-4262	CLIP-seq
MIRT2525136	hsa-miR-4266	CLIP-seq
MIRT2525137	hsa-miR-4270	CLIP-seq
MIRT2525138	hsa-miR-4279	CLIP-seq
MIRT2525139	hsa-miR-4297	CLIP-seq
MIRT2525140	hsa-miR-4319	CLIP-seq
MIRT968637	hsa-miR-4419b	CLIP-seq
MIRT2437060	hsa-miR-4420	CLIP-seq
MIRT968638	hsa-miR-4433	CLIP-seq
MIRT2525141	hsa-miR-4441	CLIP-seq
MIRT968639	hsa-miR-4459	CLIP-seq
MIRT2525142	hsa-miR-4461	CLIP-seq
MIRT968642	hsa-miR-4478	CLIP-seq
MIRT2525143	hsa-miR-4494	CLIP-seq
MIRT2525144	hsa-miR-4501	CLIP-seq
MIRT2525145	hsa-miR-4530	CLIP-seq
MIRT2437063	hsa-miR-4633-5p	CLIP-seq
MIRT2387519	hsa-miR-4635	CLIP-seq
MIRT2525146	hsa-miR-4643	CLIP-seq
MIRT968643	hsa-miR-4649-3p	CLIP-seq
MIRT2525147	hsa-miR-466	CLIP-seq
MIRT2525148	hsa-miR-4660	CLIP-seq
MIRT2437066	hsa-miR-4666-3p	CLIP-seq
MIRT2437067	hsa-miR-4668-3p	CLIP-seq
MIRT2525149	hsa-miR-4685-5p	CLIP-seq
MIRT2437068	hsa-miR-4689	CLIP-seq
MIRT2437069	hsa-miR-4691-3p	CLIP-seq
MIRT2525150	hsa-miR-4695-3p	CLIP-seq
MIRT968644	hsa-miR-4695-5p	CLIP-seq
MIRT2437070	hsa-miR-4700-3p	CLIP-seq
MIRT2525151	hsa-miR-4710	CLIP-seq
MIRT2525152	hsa-miR-4717-3p	CLIP-seq
MIRT1987098	hsa-miR-4722-5p	CLIP-seq
MIRT2525153	hsa-miR-4728-5p	CLIP-seq
MIRT2525154	hsa-miR-4732-3p	CLIP-seq
MIRT2525155	hsa-miR-4749-3p	CLIP-seq
MIRT2437072	hsa-miR-4755-3p	CLIP-seq
MIRT2525156	hsa-miR-4761-5p	CLIP-seq
MIRT968645	hsa-miR-4768-3p	CLIP-seq
MIRT2525157	hsa-miR-4773	CLIP-seq
MIRT2525158	hsa-miR-4774-5p	CLIP-seq
MIRT968646	hsa-miR-4787-3p	CLIP-seq
MIRT2525159	hsa-miR-4789-3p	CLIP-seq
MIRT968647	hsa-miR-4793-3p	CLIP-seq
MIRT2525160	hsa-miR-4793-5p	CLIP-seq
MIRT1921211	hsa-miR-4795-3p	CLIP-seq
MIRT2525161	hsa-miR-4802-3p	CLIP-seq
MIRT1921212	hsa-miR-4803	CLIP-seq
MIRT968648	hsa-miR-485-5p	CLIP-seq
MIRT968650	hsa-miR-490-3p	CLIP-seq
MIRT2525162	hsa-miR-490-5p	CLIP-seq
MIRT2525163	hsa-miR-499a-5p	CLIP-seq
MIRT2525164	hsa-miR-5047	CLIP-seq
MIRT2525165	hsa-miR-513c	CLIP-seq
MIRT2525166	hsa-miR-514b-5p	CLIP-seq
MIRT2437074	hsa-miR-520a-5p	CLIP-seq
MIRT2437075	hsa-miR-525-5p	CLIP-seq
MIRT2437077	hsa-miR-532-5p	CLIP-seq
MIRT2437078	hsa-miR-543	CLIP-seq
MIRT2525167	hsa-miR-548a-5p	CLIP-seq
MIRT2525168	hsa-miR-548ab	CLIP-seq
MIRT2525169	hsa-miR-548ak	CLIP-seq
MIRT2525170	hsa-miR-548b-5p	CLIP-seq
MIRT968652	hsa-miR-548c-3p	CLIP-seq
MIRT2525171	hsa-miR-548c-5p	CLIP-seq
MIRT2525172	hsa-miR-548d-5p	CLIP-seq
MIRT2525173	hsa-miR-548h	CLIP-seq
MIRT2525174	hsa-miR-548i	CLIP-seq
MIRT2525175	hsa-miR-548j	CLIP-seq
MIRT2221506	hsa-miR-548n	CLIP-seq
MIRT2437079	hsa-miR-548q	CLIP-seq
MIRT2525176	hsa-miR-548s	CLIP-seq
MIRT2525177	hsa-miR-548w	CLIP-seq
MIRT2525178	hsa-miR-548y	CLIP-seq
MIRT2525179	hsa-miR-559	CLIP-seq
MIRT968654	hsa-miR-607	CLIP-seq
MIRT968655	hsa-miR-612	CLIP-seq
MIRT2525180	hsa-miR-628-3p	CLIP-seq
MIRT2437081	hsa-miR-631	CLIP-seq
MIRT2525181	hsa-miR-640	CLIP-seq
MIRT2525182	hsa-miR-670	CLIP-seq
MIRT968657	hsa-miR-767-3p	CLIP-seq
MIRT2437083	hsa-miR-877	CLIP-seq
MIRT2525183	hsa-miR-888	CLIP-seq
MIRT2525184	hsa-miR-889	CLIP-seq
MIRT968658	hsa-miR-940	CLIP-seq
MIRT2437035	hsa-miR-1224-5p	CLIP-seq
MIRT2525114	hsa-miR-1228	CLIP-seq
MIRT2680259	hsa-miR-1236	CLIP-seq
MIRT2525116	hsa-miR-1258	CLIP-seq
MIRT2525117	hsa-miR-125a-5p	CLIP-seq
MIRT2525118	hsa-miR-125b	CLIP-seq
MIRT2437037	hsa-miR-1277	CLIP-seq
MIRT968614	hsa-miR-1285	CLIP-seq
MIRT2437038	hsa-miR-1304	CLIP-seq
MIRT2437039	hsa-miR-135a	CLIP-seq
MIRT2437040	hsa-miR-135b	CLIP-seq
MIRT968617	hsa-miR-150	CLIP-seq
MIRT2221495	hsa-miR-181a	CLIP-seq
MIRT2221496	hsa-miR-181b	CLIP-seq
MIRT2221497	hsa-miR-181c	CLIP-seq
MIRT2221498	hsa-miR-181d	CLIP-seq
MIRT968618	hsa-miR-1827	CLIP-seq
MIRT2525120	hsa-miR-1913	CLIP-seq
MIRT2221499	hsa-miR-1915	CLIP-seq
MIRT968619	hsa-miR-2114	CLIP-seq
MIRT2437043	hsa-miR-219-1-3p	CLIP-seq
MIRT2437044	hsa-miR-2355-5p	CLIP-seq
MIRT2680260	hsa-miR-24	CLIP-seq
MIRT2525122	hsa-miR-3122	CLIP-seq
MIRT2437045	hsa-miR-3125	CLIP-seq
MIRT968626	hsa-miR-3145-5p	CLIP-seq
MIRT2437046	hsa-miR-3157-5p	CLIP-seq
MIRT2525123	hsa-miR-3165	CLIP-seq
MIRT968627	hsa-miR-3187-5p	CLIP-seq
MIRT2525124	hsa-miR-324-3p	CLIP-seq
MIRT2525125	hsa-miR-325	CLIP-seq
MIRT2437048	hsa-miR-33a	CLIP-seq
MIRT2437049	hsa-miR-33b	CLIP-seq
MIRT2437050	hsa-miR-34c-3p	CLIP-seq
MIRT2525126	hsa-miR-3613-3p	CLIP-seq
MIRT968629	hsa-miR-3622b-5p	CLIP-seq
MIRT2525127	hsa-miR-3647-3p	CLIP-seq
MIRT2437051	hsa-miR-3661	CLIP-seq
MIRT2437052	hsa-miR-3662	CLIP-seq
MIRT968630	hsa-miR-3664-3p	CLIP-seq
MIRT968631	hsa-miR-3671	CLIP-seq
MIRT2525128	hsa-miR-3672	CLIP-seq
MIRT968632	hsa-miR-3682-5p	CLIP-seq
MIRT2525129	hsa-miR-3689a-3p	CLIP-seq
MIRT2525130	hsa-miR-3689c	CLIP-seq
MIRT2525131	hsa-miR-3689d	CLIP-seq
MIRT2525132	hsa-miR-371-5p	CLIP-seq
MIRT2525133	hsa-miR-371b-5p	CLIP-seq
MIRT2437053	hsa-miR-376a	CLIP-seq
MIRT2437054	hsa-miR-376b	CLIP-seq
MIRT2437055	hsa-miR-3907	CLIP-seq
MIRT2525134	hsa-miR-3913-5p	CLIP-seq
MIRT2437056	hsa-miR-3915	CLIP-seq
MIRT2437057	hsa-miR-3916	CLIP-seq
MIRT2525135	hsa-miR-3926	CLIP-seq
MIRT2437058	hsa-miR-3928	CLIP-seq
MIRT968633	hsa-miR-3929	CLIP-seq
MIRT968634	hsa-miR-3945	CLIP-seq
MIRT1987096	hsa-miR-410	CLIP-seq
MIRT968635	hsa-miR-4252	CLIP-seq
MIRT968636	hsa-miR-4253	CLIP-seq
MIRT2437059	hsa-miR-4257	CLIP-seq
MIRT2221501	hsa-miR-4262	CLIP-seq
MIRT2525136	hsa-miR-4266	CLIP-seq
MIRT2525137	hsa-miR-4270	CLIP-seq
MIRT2525138	hsa-miR-4279	CLIP-seq
MIRT2525139	hsa-miR-4297	CLIP-seq
MIRT2525140	hsa-miR-4319	CLIP-seq
MIRT2680261	hsa-miR-4329	CLIP-seq
MIRT968637	hsa-miR-4419b	CLIP-seq
MIRT2437060	hsa-miR-4420	CLIP-seq
MIRT968638	hsa-miR-4433	CLIP-seq
MIRT2525141	hsa-miR-4441	CLIP-seq
MIRT968639	hsa-miR-4459	CLIP-seq
MIRT2525142	hsa-miR-4461	CLIP-seq
MIRT968642	hsa-miR-4478	CLIP-seq
MIRT2221502	hsa-miR-4491	CLIP-seq
MIRT2525143	hsa-miR-4494	CLIP-seq
MIRT2525144	hsa-miR-4501	CLIP-seq
MIRT2525145	hsa-miR-4530	CLIP-seq
MIRT2437063	hsa-miR-4633-5p	CLIP-seq
MIRT2387519	hsa-miR-4635	CLIP-seq
MIRT2525146	hsa-miR-4643	CLIP-seq
MIRT968643	hsa-miR-4649-3p	CLIP-seq
MIRT2221504	hsa-miR-4657	CLIP-seq
MIRT2525147	hsa-miR-466	CLIP-seq
MIRT2437066	hsa-miR-4666-3p	CLIP-seq
MIRT2437067	hsa-miR-4668-3p	CLIP-seq
MIRT2525149	hsa-miR-4685-5p	CLIP-seq
MIRT2437068	hsa-miR-4689	CLIP-seq
MIRT2437069	hsa-miR-4691-3p	CLIP-seq
MIRT2525150	hsa-miR-4695-3p	CLIP-seq
MIRT968644	hsa-miR-4695-5p	CLIP-seq
MIRT2437070	hsa-miR-4700-3p	CLIP-seq
MIRT2437071	hsa-miR-4709-3p	CLIP-seq
MIRT2525152	hsa-miR-4717-3p	CLIP-seq
MIRT1987098	hsa-miR-4722-5p	CLIP-seq
MIRT2525153	hsa-miR-4728-5p	CLIP-seq
MIRT2525154	hsa-miR-4732-3p	CLIP-seq
MIRT2525155	hsa-miR-4749-3p	CLIP-seq
MIRT2437072	hsa-miR-4755-3p	CLIP-seq
MIRT2525156	hsa-miR-4761-5p	CLIP-seq
MIRT2437073	hsa-miR-4765	CLIP-seq
MIRT968645	hsa-miR-4768-3p	CLIP-seq
MIRT2525157	hsa-miR-4773	CLIP-seq
MIRT2525158	hsa-miR-4774-5p	CLIP-seq
MIRT968646	hsa-miR-4787-3p	CLIP-seq
MIRT2525159	hsa-miR-4789-3p	CLIP-seq
MIRT968647	hsa-miR-4793-3p	CLIP-seq
MIRT2525160	hsa-miR-4793-5p	CLIP-seq
MIRT1921211	hsa-miR-4795-3p	CLIP-seq
MIRT2525161	hsa-miR-4802-3p	CLIP-seq
MIRT1921212	hsa-miR-4803	CLIP-seq
MIRT968648	hsa-miR-485-5p	CLIP-seq
MIRT968650	hsa-miR-490-3p	CLIP-seq
MIRT2525162	hsa-miR-490-5p	CLIP-seq
MIRT2525163	hsa-miR-499a-5p	CLIP-seq
MIRT2525165	hsa-miR-513c	CLIP-seq
MIRT2525166	hsa-miR-514b-5p	CLIP-seq
MIRT2437074	hsa-miR-520a-5p	CLIP-seq
MIRT2437075	hsa-miR-525-5p	CLIP-seq
MIRT2437077	hsa-miR-532-5p	CLIP-seq
MIRT2437078	hsa-miR-543	CLIP-seq
MIRT968652	hsa-miR-548c-3p	CLIP-seq
MIRT2437079	hsa-miR-548q	CLIP-seq
MIRT2525176	hsa-miR-548s	CLIP-seq
MIRT2221507	hsa-miR-563	CLIP-seq
MIRT2221508	hsa-miR-576-3p	CLIP-seq
MIRT2680262	hsa-miR-593	CLIP-seq
MIRT968654	hsa-miR-607	CLIP-seq
MIRT968655	hsa-miR-612	CLIP-seq
MIRT2525180	hsa-miR-628-3p	CLIP-seq
MIRT2437081	hsa-miR-631	CLIP-seq
MIRT2525181	hsa-miR-640	CLIP-seq
MIRT2525182	hsa-miR-670	CLIP-seq
MIRT968657	hsa-miR-767-3p	CLIP-seq
MIRT2437082	hsa-miR-873	CLIP-seq
MIRT2437083	hsa-miR-877	CLIP-seq
MIRT2525183	hsa-miR-888	CLIP-seq
MIRT2525184	hsa-miR-889	CLIP-seq
MIRT968658	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
KDM2A	Repression	23074094
NFIL3	Unknown	1620116
WT1	Unknown	17430890

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001550	Process	Ovarian cumulus expansion	IEA
GO:0001550	Process	Ovarian cumulus expansion	ISS
GO:0001556	Process	Oocyte maturation	IEA
GO:0001556	Process	Oocyte maturation	ISS
GO:0001819	Process	Positive regulation of cytokine production	IDA	10681561
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005154	Function	Epidermal growth factor receptor binding	IEA
GO:0005154	Function	Epidermal growth factor receptor binding	ISS
GO:0005154	Function	Epidermal growth factor receptor binding	TAS	10681561
GO:0005515	Function	Protein binding	IPI	9419975, 28988771, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9556621, 28783046
GO:0005615	Component	Extracellular space	IDA	9337852, 14581411
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9337852
GO:0007143	Process	Female meiotic nuclear division	IEA
GO:0007143	Process	Female meiotic nuclear division	ISS
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	9556621, 28783046
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	ISS	9990076
GO:0007267	Process	Cell-cell signaling	IDA	14581411
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10681561
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0009299	Process	MRNA transcription	IDA	10681561
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9337852
GO:0009887	Process	Animal organ morphogenesis	TAS	9337852
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	9419975
GO:0030154	Process	Cell differentiation	IEA
GO:0030216	Process	Keratinocyte differentiation	TAS	10681561
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	9556621, 28783046
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030728	Process	Ovulation	IEA
GO:0030728	Process	Ovulation	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0038134	Process	ERBB2-EGFR signaling pathway	IDA	9556621
GO:0038135	Process	ERBB2-ERBB4 signaling pathway	IDA	9556621
GO:0038138	Process	ERBB4-ERBB4 signaling pathway	IDA	9556621
GO:0042060	Process	Wound healing	TAS	12898511
GO:0042327	Process	Positive regulation of phosphorylation	IDA	9419975, 10681561
GO:0042700	Process	Luteinizing hormone signaling pathway	IEA
GO:0042700	Process	Luteinizing hormone signaling pathway	ISS
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043616	Process	Keratinocyte proliferation	IDA	10681561
GO:0045089	Process	Positive regulation of innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	ISS
GO:0045740	Process	Positive regulation of DNA replication	IDA	9337852, 10681561
GO:0045740	Process	Positive regulation of DNA replication	IEA
GO:0045740	Process	Positive regulation of DNA replication	ISS	9990076
GO:0045840	Process	Positive regulation of mitotic nuclear division	IBA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IEA
GO:0045840	Process	Positive regulation of mitotic nuclear division	ISS	9990076
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	14581411
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	14581411
GO:0048018	Function	Receptor ligand activity	IDA	9556621, 28783046
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	12702554
GO:0048160	Process	Primary follicle stage	IEA
GO:0048160	Process	Primary follicle stage	ISS
GO:0048513	Process	Animal organ development	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS	9990076
GO:0050680	Process	Negative regulation of epithelial cell proliferation	TAS	10681561
GO:0051151	Process	Negative regulation of smooth muscle cell differentiation	IDA	14581411
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051781	Process	Positive regulation of cell division	IEA

Other IDs

• MIM: 602061
• HGNC: 3443
• e!Ensembl: ENSG00000124882

Protein

• UniProt ID: O14944
• Protein name: Proepiregulin [Cleaved into: Epiregulin (EPR)]
• Protein function: Ligand of the EGF receptor/EGFR and ERBB4. Stimulates EGFR and ERBB4 tyrosine phosphorylation (PubMed:9419975). Contributes to inflammation, wound healing, tissue repair, and oocyte maturation by regulating angiogenesis and vascular remodeling a
• PDB: 1K36, 1K37, 5E8D, 5WB7, 7LEN, 7LFR, 7LFS, 8HGP
• Tissue specificity: TISSUE SPECIFICITY: In normal adults, expressed predominantly in the placenta and peripheral blood leukocytes. High levels were detected in carcinomas of the bladder, lung, kidney and colon. {ECO:0000269|PubMed:9337852}.
• Sequence:

  MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
  AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVA
  LTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV

• Sequence length: 169

Pathways

KEGG:

MAPK signaling pathway
ErbB signaling pathway
PI3K-Akt signaling pathway
Colorectal cancer

Reactome:

Signaling by ERBB2
Signaling by ERBB4
SHC1 events in ERBB2 signaling
PI3K events in ERBB4 signaling
SHC1 events in ERBB4 signaling
PIP3 activates AKT signaling
Signaling by EGFR
GRB2 events in EGFR signaling
GAB1 signalosome
SHC1 events in EGFR signaling
EGFR downregulation
GRB2 events in ERBB2 signaling
PI3K events in ERBB2 signaling
EGFR interacts with phospholipase C-gamma
Constitutive Signaling by Aberrant PI3K in Cancer
Inhibition of Signaling by Overexpressed EGFR
RAF/MAP kinase cascade
ERBB2 Regulates Cell Motility
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
ERBB2 Activates PTK6 Signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Downregulation of ERBB2 signaling
Extra-nuclear estrogen signaling
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 TMD/JMD mutants

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERYTHROPOIETIC PROTOPORPHYRIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTOPORPHYRIA, ERYTHROPOIETIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC CREUTZFELD JACOB DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	22964644		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22964644		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	27270421		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33981288	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	31696167		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	27023590	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28366802		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	14581411		★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	18292222		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	10891365		★☆☆☆☆ Found in Text Mining only
Anophthalmos with limb anomalies	Anophthalmia	Pubtator	25576212	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	32284770	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29744301		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	25556244		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	27165343	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24309559	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27808402, 31617730	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30036600, 31443605		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	22142990	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24423463	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29744301		★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	30302601		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	29257318	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	23625463		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	23625463	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	16273733	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	28143986	Associate	★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	31504407	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	17695462, 22142990, 22547541, 24060578, 24625110, 24761771	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23224376	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10037815, 10070900, 10235476, 10623650, 10638965, 10815760, 10823126, 11042612, 11056692, 11064673, 11205318, 11308260, 11398888, 11474128, 11556039, 11710964, 12208864, 12496244, 12527756, 12527894, 12548595, 12841681, 1419611, 14572667, 14582137, 14979917, 15016320, 15090535, 1517234, 15178330, 15182430, 15220474, 15329896, 15477868, 15546506, 15619641, 15628988, 15662126, 15735025, 15736439, 1587835, 15891768, 15917412, 15965230, 16080475, 16085689, 16168139, 16189159, 16393696, 16417650, 16608856, 16679312, 16684779, 16685445, 16760293, 16769725, 16778215, 16784538, 16799708, 16805920, 16892043, 16980581, 17054791, 17166846, 17172825, 17393355, 17407600, 17457609, 17591932, 17598908, 17611401, 17712311, 17872899, 17883861, 17925008, 17932744, 17962208, 17963508, 17965220, 17997862, 18059023, 18171986, 18210742, 18211679, 18226260, 18254957, 18266105, 18286776, 18383888, 18445275, 18471979, 18550772, 18588516, 18593943, 18617595, 18628976, 18632615, 18668364, 18752050, 18755890, 18813793, 18828867, 18922159, 18927304, 18928543, 18941930, 19000652, 19005469, 19016568, 19018258, 19028704, 19034514, 19055788, 19082460, 19117995, 19125296, 19136201, 19151744, 19208263, 19289846, 19340624, 19342880, 19351845, 19419938, 19432961, 19459041, 19495794, 19536326, 19549328, 19563679, 19619298, 19632824, 19651608, 19723326, 19762712, 19796866, 19821025, 19839584, 19840189, 19846938, 19920189, 19933843, 19946334, 19967414, 20043081, 20068186, 20104967, 20144226, 20154269, 20181721, 20204298, 20233903, 20237034, 20370918, 20382698, 20395295, 20457620, 20479250, 20479999, 20490964, 20492711, 20515469, 20516217, 20565850, 20602252, 20646288, 20697068, 20736952, 20821348, 20886231, 20939012, 20949095, 21059815, 21062454, 21063412, 21080930, 21087507, 21151129, 21152022, 21152100, 21172654, 21214954, 21221771, 21225456, 21263059, 21276137, 21298336, 21304180, 21328542, 21329183, 21346144, 21364760, 21387162, 21396094, 21437249, 21479875, 21499685, 21501481, 21542805, 21552322, 2155643, 21559012, 21569413, 21575280, 21596841, 21631949, 21641572, 21655659, 21658239, 21701558, 21750172, 21761335, 21761367, 21784954, 21785460, 21805138, 21884980, 21896991, 21939527, 21939528, 21968648, 21978456, 22022496, 22025563, 22037553, 22053997, 22083956, 22128125, 22134837, 22174609, 22217937, 22240506, 22249258, 22260523, 22262870, 22276155, 22279038, 22286759, 22293249, 22331459, 22343619, 22359603, 22362584, 22367215, 22371223, 22417870, 22426783, 22429491, 22430806, 22433433, 22433870, 22452927, 22532584, 22538770, 22538974, 22542536, 22547541, 22577295, 22586443, 22608253, 22618884, 22631675, 22647834, 22648732, 22658320, 22690709, 22719901, 22738860, 22751729, 22792365, 22799290, 22799738, 22825349, 22854050, 22860018, 22879957, 22885356, 22912703, 22927910, 22929433, 22954666, 22961208, 22966753, 22971289, 22987970, 23039280, 23079975, 23134774, 23157797, 23159930, 23166647, 23216981, 23227519, 23242584, 23244108, 23244146, 23299531, 23317209, 23322423, 23341997, 23342080, 23346221, 23347430, 23374155, 23389114, 23448346, 23493347, 23519058, 23535733, 23558572, 23579222, 23592399, 23595559, 23643682, 23650283, 23681011, 23686416, 23695023, 23704933, 23725118, 23776684, 23812955, 23816933, 23828499, 23857602, 23874500, 23875016, 23876235, 23886187, 23892410, 23902710, 23907131, 23939832, 23977244, 24008095, 24019942, 24033728, 24060578, 24065467, 24086515, 24119434, 24125069, 24157828, 24167368, 24169358, 24177593, 24185510, 24203627, 24207091, 24228128, 24245483, 24263101, 24344008, 24355881, 24398991, 24399649, 24409301, 24457069, 24458471, 24467886, 24488910, 24489661, 24495353, 24500980, 24515104, 24520381, 24549642, 24563630, 24564526, 24588102, 24622579, 24627205, 24645668, 24684682, 24685596, 24694649, 24716804, 24731990, 24743323, 24752803, 24761771, 24815488, 24816718, 24839032, 24864130, 24889938, 24916694, 24962896, 24970479, 25001387, 25003667, 25068292, 25069039, 25070343, 25070479, 25079324, 25080362, 25104095, 25111287, 25124582, 25131496, 25179838, 25203051, 25213081, 25216520, 25218890, 25220225, 25240289, 25248717, 25269750, 25295793, 25307233, 25337278, 25338681, 25339035, 25352556, 25358600, 25373603, 25395315, 25400119, 25406994, 25420785, 25421376, 25429617, 2547412, 25529635, 25542925, 25570853, 25575444, 25613123, 25617853, 25617865, 25644501, 25684473, 25706943, 25721606, 25739705, 25756514, 25773928, 25779659, 25788266, 25850931, 25881544, 25883221, 25884832, 25885472, 25886003, 25923108, 25927974, 25944846, 25971350, 26003169, 26008983, 26028092, 26041837, 26049585, 2605095, 26091472, 26097589, 26103053, 26141719, 26147891, 26158350, 26161666, 26178788, 26182949, 26238439, 26244666, 26251034, 26284334, 26302375, 26304457, 26319120, 26339424, 26348443, 26350565, 26375671, 26416600, 26421711, 26446398, 26448179, 26458823, 26496879, 26529585, 26530965, 26563128, 26610383, 26625764, 26659386, 26660119, 26686201, 26703974, 26745129, 26783290, 26810571, 26812885, 26867046, 26895349, 26937933, 27017931, 27018307, 27022068, 27032101, 27036195, 27041579, 27043307, 27061526, 27109102, 27113214, 27117709, 27126994, 27152840, 27174596, 27178224, 27206678, 27211549, 27246191, 27250026, 27287781, 27301701, 27353038, 27362843, 27388210, 27402876, 27404455, 27456970, 27467053, 27467526, 27469239, 27502118, 27507245, 27514395, 27525837, 27544930, 27552096, 27556157, 27556229, 27556950, 27565181, 27573671, 27580430, 27592113, 27599752, 27601076, 27612043, 27612429, 27628678, 27629141, 27634906, 27638884, 27640304, 27662272, 27672107, 27702820, 27713164, 27729430, 27748765, 27753529, 27764800, 27771839, 27791031, 27818374, 27829232, 27853906, 27856629, 27861902, 27925203, 27983521, 27993329, 27997592, 28005906, 28006839, 28009468, 28032978, 28055379, 28057031, 28061893, 28076334, 28081544, 28084344, 28111076, 28118602, 28141868, 28143986, 28162269, 28179314, 28192639, 28208155, 28213701, 28256629, 28270497, 28272969, 28273452, 28276317, 28301514, 28301567, 28332571, 28345661, 28356061, 28365833, 28376175, 28388540, 28404972, 28407750, 28423537, 28424414, 28427228, 28429243, 28468300, 28490348, 28522855, 28528450, 28532429, 28534527, 28535794, 28542297, 28588280, 28617547, 28630419, 28652562, 28679775, 28766230, 28776283, 28794284, 28795252, 28838210, 28851309, 28855612, 28859291, 28869838, 28874413, 28886093, 28891017, 28935545, 28965971, 28972307, 28975977, 29039577, 29041978, 29073583, 29099263, 29110491, 29116467, 29117208, 29128895, 29128896, 29131020, 29133365, 29133514, 29141657, 29158285, 29191181, 29218898, 29251737, 29278880, 29289986, 29306943, 29320557, 29330437, 29345254, 29371476, 29386247, 29390981, 29482551, 29520654, 29566741, 29573739, 29581135, 29608602, 29665850, 29734483, 29779937, 29843638, 29873413, 29880014, 29895970, 29902286, 29914974, 29924962, 29958276, 29970036, 29987050, 29991699, 30087366, 30089167, 30091186, 30092766, 30119678, 30153655, 30158597, 30161001, 30177847, 30179299, 30180877, 30181553, 30242578, 30247654, 30287915, 30321299, 30361903, 30403669, 30404440, 30410061, 30443844, 30457555, 30458661, 30489256, 30497079, 30509058, 30543347, 30560461, 30605443, 30616080, 30646914, 30648747, 30649385, 30651078, 30652258, 30655324, 30665944, 30678243, 30691046, 30702971, 30704458, 30723304, 30756285, 30795773, 30811755, 30852142, 30860570, 30860573, 30866857, 30867218, 30867590, 30878502, 30910842, 30920963, 30932749, 30951390, 30982598, 30987655, 31059536, 31121213, 31151151, 31168174, 31189691, 31199586, 31201584, 31209664, 31233192, 31251818, 31302854, 31308460, 31317673, 31322183, 31358837, 31395854, 31424658, 31432367, 31450891, 31469419, 31490549, 31504407, 31535320, 31551256, 31558802, 31562808, 31603099, 31656498, 31675683, 31675929, 31675993, 31683867, 31690832, 31748278, 31754354, 31759353, 31760402, 31780778, 31790959, 31809240, 31819783, 31839155, 31841262, 31848385, 3186693, 31891807, 31892336, 31949157, 31990579, 32001714, 32019671, 32084531, 32093034, 32115800, 32129154, 32160387, 32200487, 32210727, 32279409, 32312891, 32325372, 32344635, 32381587, 32440535, 32452826, 32460816, 32489146, 32546843, 32566979, 32587399, 32591490, 32592349, 32601800, 32603024, 32609836, 32620918, 32622530, 32682413, 32692484, 32701512, 32711554, 32716908, 32788048, 32811558, 32843722, 32854772, 32859560, 32908867, 32917222, 3291921, 32939053, 32940689, 32958578, 32960377, 33008833, 33019623, 33046470, 33086721, 33098638, 33099086, 33108409, 33112819, 33112838, 33143224, 33148314, 33154551, 33184106, 33184109, 33228656, 33353943, 33462336, 33513026, 33536276, 33574966, 33582945, 33608588, 33635448, 33652854, 33667252, 33676547, 33694315, 33725987, 33761970, 33766090, 33770100, 33852600, 33861751, 33903732, 33923732, 33937624, 33984674, 33991172, 34011560, 34011996, 34022815, 34024810, 34057115, 34067619, 34130640, 34139575, 34158394, 34174935, 34234742, 34273466, 34275890, 34315439, 34373577, 34392603, 34394279, 34407787, 34452998, 34453638, 34477239, 34520399, 34544424, 34567804, 34696631, 34725165, 34763270, 34783649, 34783927, 34792178, 34825659, 34831231, 34903452, 34990474, 35035775, 35074178, 35078818, 35087170, 35093083, 35093383, 35121200, 35151276, 35172273, 35217640, 35231585, 35241469, 35262190, 35263321, 35395775, 35401937, 35428842, 35440136, 35466619, 35476550, 35501367, 35543923, 35558081, 35605014, 35626709, 35627287, 35654829, 35657638, 35671075, 35671774, 35680073, 35726195, 35752724, 35757841, 35864159, 35917687, 35946088, 35950920, 35950923, 35980268, 35985932, 36008376, 36043530, 36083147, 36085534, 36126477, 36129548, 36139419, 36161312, 36198774, 36209141, 36252018, 36293165, 36316045, 36356581, 36384125, 36395883, 36401316, 36410675, 36419768, 36429038, 36434659, 36441548, 36446041, 36454866, 36469363, 36473847, 36524361, 36527133, 36531979, 36555293, 36581998, 36592233, 36652667, 36677847, 36691073, 36705562, 36721218, 36725920, 36757899, 36792625, 36856112, 36875478, 36899920, 36905771, 36927310, 36930833, 36977973, 36997866, 37024949, 37061618, 37070323, 37070653, 37092543, 37142671, 37143115, 37161532, 37166494, 37226020, 37244387, 37261814, 37272757, 37288296, 37299011, 37321964, 37348019, 37363949, 37400769, 37439680, 37446555, 37454014, 37462784, 37468002, 37492896, 37493170, 37495653, 37500962, 37501682, 37524698, 37524746, 37540479, 37553911, 37556015, 37686099, 37711168, 37725704, 37740038, 37747009, 37766666, 37768345, 37779428, 37784177, 37794289, 37798646, 37847456, 37873865, 37884178, 37925055, 37963835, 38052873, 38059884, 38072513, 38072514, 38090235, 38103327, 38136668, 38166892, 38182687, 38243319, 38254989, 38263420, 38282415, 38450704, 38564418, 38643489, 39207954, 39242688, 39243563, 39261800, 39272208, 39519124, 39587695, 39633505, 39985907, 40016720, 40054585, 40067793, 40288678, 40300005, 40345424, 40378044, 40392928, 40534514, 40594685, 40604083, 40632306, 40724972, 7149814, 7510292, 7515559, 7541332, 7542977, 7734323, 7880720, 8198966, 8334681, 8394731, 8509439, 8519657, 8581274, 8630288, 8805931, 8883409, 9000593, 9137105, 9460986, 9632722, 9649124, 9662256, 9667651, 9831541, 9836473	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15073596, 18516291, 18755024, 22901142, 23167382, 24122263, 24523857, 31703083, 34018684, 34636027, 37935787	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18442419, 26578401, 29699511, 30509049, 3580270, 37469520	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	33964913, 40302091	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	23939832	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20821348, 23624782, 23704974, 23875016, 25469035	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	15274392, 28069049	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22491422		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	20614336, 29109770	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35476550	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	11994759, 12368191, 16512896, 20680643, 22203942, 24917206, 25339035, 28365833, 28717182, 30129697, 39207954	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	17245003, 27569075	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	18225556, 19066611, 22119825, 24996968, 26319120, 27152840	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	20149218	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	16648864, 26045795, 31495455, 37773079	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17589901, 29085224, 35915607, 40216312	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33656238	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	12037031, 14735188, 18941930, 19457236, 19689789, 20424617, 21139586, 23756858, 24874483, 27589390, 29193395, 31060593, 32773767, 34717732, 40016720, 8100443	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21209395	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	16799708, 25385074, 26451490, 27837612, 28365833, 30798422, 33947745, 37500962, 37921670, 39207954, 40314919	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28472347		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19560192, 24460357, 26043844	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26169495, 32279409, 9635673	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22491422, 27223886, 34548052	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	30059451	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21769422		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37881939	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	33579347	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	33635448	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	37881939	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16936263, 20636398, 24935374	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	23826119		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	23826119, 33627146	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	23826119	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	19742314	Associate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	21784954, 26003169	Associate	★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	28398769		★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Lissencephaly	Pubtator	35647835	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36697247	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	36697247	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27270421	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21206494, 22409860, 23374602, 24335920, 27270421, 27272216, 27344184, 29199273, 30252132, 31519572		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19142184, 21283802, 22409860, 23374602, 24335920, 25469035, 25707609, 27002940, 27270421, 27272216, 30016783, 34830244, 35352485, 37363997	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	24935374		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	37812997	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	39261800	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	26087173	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30544699		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	35852181	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	31761787		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28499214, 29130334		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28499214, 29130334		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29385323		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	16168139, 18270579, 27791031, 28794284, 29608602, 31949157, 33086721, 36395883, 38072514, 39207954	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	37906431	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	21209395, 37603513	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	14689303, 15280405, 16648864, 16980945, 17649817, 20126312, 20686376, 23932335, 24030769, 24684970, 25201050, 25308734, 26299454, 26434913, 26868332, 27342949, 27384477, 28764605, 29539426, 30614867, 31268882, 32127819, 32507853, 35226658, 35796805, 36396974, 36690721, 37363949, 40243611, 9635673	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22482968, 26059197, 32416979, 33543288, 40243611	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	34794738	Inhibit	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	30989466	Associate	★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	CTD_human_DG	19267999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35880180	Associate	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	21283802	Associate	★☆☆☆☆ Found in Text Mining only
Ferrochelatase deficiency	Ferrochelatase Deficiency	CTD_human_DG	19267999		★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	11064673	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19298600		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	19298600, 35429182	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24330607		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36647156	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24330607		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24330607		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35140400	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	35876683	Inhibit	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35116032	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	40299971	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	18292222		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	16273733	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	25990537		★☆☆☆☆ Found in Text Mining only
HEMIHYPERPLASIA, ISOLATED	Hemihyperplasia	BEFREE	29744301		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	36531979	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22713661, 31168174	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23558572, 24177593, 25421376, 32859560, 40227228	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	27353038	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	23045280, 26215578, 27525837, 30361903, 36012147, 36139419	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkeratosis Epidermolytic	Epidermolytic hyperkeratosis	Pubtator	35421402	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	16869981, 29084054	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	19584059	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19724277, 22482968, 27771839, 37166494, 38282415	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36947400	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30400011		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29109770		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	31761787		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	18497965		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	25979343		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	39370847	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	33186388	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	23334251, 24222211	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20190817, 21471526, 22028862, 24240203, 34373586	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21471526	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12899712	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22516259		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	17589901, 33656238	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	25617853	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29703138		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	19138957		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25338663	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	26894620		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20642860, 22407396, 23359191, 23932335, 24864130, 25576212, 32592349, 34146382, 36454866	Associate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	19560192	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	17963508	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	LHGDN	15274392		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24330607		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17962208, 28274874		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28472347		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	15313392		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21769422		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10891365		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20651988		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22508389, 25203737, 30738695		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23549083, 25990537, 27744564, 29130334, 29572902, 30677557, 31234944, 31683673		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17962208		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32150843, 36499700, 38294692, 9182820	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	8347484	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	26456840	Inhibit	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	34113003	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	25234470	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	38250159	Associate	★☆☆☆☆ Found in Text Mining only
Mucolipidoses	Mucolipidosis	Pubtator	29084054	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11429412	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37329522, 9716605	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34950135, 40299057	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	11182013, 28398769	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	28398769		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	23992566	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	34681897	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10891365, 15520187, 19138957, 19738126, 19925653, 21161326, 21283802, 22030282, 22409860, 23374602, 23549083, 24335920, 24687921, 25520391, 25677871, 26215578, 26284333, 26370161, 26894620, 27002940, 27270421, 27272216, 27422777, 28255348, 28351146, 28839211, 28841547, 28986856, 29086481, 29109770, 29138565, 29318941, 29786605, 29792309, 30639548, 30677557, 30738695, 30771581, 31234944, 31383134, 31421407, 31519572, 31571868, 31744896, 31808011		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	16462207		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23071666	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27130034		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	29032173		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19138957, 22964644		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	26215578		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30255696, 30862719, 36139419	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34671129	Stimulate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	19142184	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30967627		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	31249201	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	18081879, 36066162	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22547541	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	25526766	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	15313392		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21769422		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22549810, 23845225, 2386737, 24460357, 26059197, 26937756, 27139372, 28376175, 28859612, 31495455, 33148925, 33891016, 34711431, 36178284, 36674737, 37169775, 37610061, 39201357, 9888466	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pachyonychia Congenita	Pachyonychia congenita	Pubtator	36116508	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10891365		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32596278	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	10891365		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	11064673	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21951066	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	19401830	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	29206944, 29734187, 35872929, 39587695	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29734187		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	6831048, 9160662	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20651988		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	28261681	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21139866, 25219910, 28448495	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	35967373	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27808402	Associate	★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	25402004		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24309559		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	26168722	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	34671129	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	17664471, 19738126, 21283802, 23099994, 24800946, 25520391, 26284333, 26341080, 27002940, 27272216, 27344184, 31519572		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	27061526	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	25707609	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	18292222		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29744301		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15152945		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	9421477	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18497965, 31234944		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18497965		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23625689, 27475696, 32144339, 38250159	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30302873		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25203737, 30738695		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10376983, 25203737, 30873760, 36631634	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	28960674		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	37747009	Associate	★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	28783046		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35162942	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid hormone resistance	Pubtator	20886231, 30560461	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25576212, 36604958, 37288296	Associate	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	16457695, 20814817, 24008095, 24409301, 24581278, 24721635, 26267318, 29728051, 35880180, 36725920, 37120672, 40288678, 40635123	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21437249, 25208879, 25413873, 35875026	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31674634		★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	16469638		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	18292222		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	18292222	Associate	★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	28282589		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22965848	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17137618, 33723286, 36674737	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	27260518	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	34162378	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	32096196	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	20204298	Associate	★☆☆☆☆ Found in Text Mining only