ERBB3 (erb-b2 receptor tyrosine kinase 3)

Gene

• Entrez ID: 2065
• Gene name: Erb-b2 receptor tyrosine kinase 3
• Gene symbol: ERBB3
• Synonyms (NCBI Gene): ErbB-3, FERLK, HER3, LCCS2, MDA-BF-1, VSCN1, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3
• Chromosome: 12
• Chromosome location: 12q13.2
• Summary: This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey th

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs755855285	G>A	Likely-pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant
rs931676601	A>G,T	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs1057519169	G>A	Likely-pathogenic	Splice donor variant, genic downstream transcript variant
rs1057519803	G>A	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519817	C>A,G	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519891	G>A,T	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519892	A>T	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs1057519893	G>A,T	Likely-pathogenic	Missense variant, coding sequence variant
rs1592232580	C>T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003659	hsa-miR-205-5p	Luciferase reporter assay	19238171
MIRT003659	hsa-miR-205-5p	Review	20026422
MIRT003659	hsa-miR-205-5p	Luciferase reporter assay	20065103
MIRT005117	hsa-miR-125a-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	17110380
MIRT005117	hsa-miR-125a-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	17110380
MIRT002938	hsa-miR-125b-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	17110380
MIRT002938	hsa-miR-125b-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	17110380
MIRT003659	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	19276373
MIRT003659	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	19276373
MIRT005117	hsa-miR-125a-5p	Luciferase reporter assay, Microarray, Western blot	20864407
MIRT003659	hsa-miR-205-5p	Luciferase reporter assay, Microarray, Western blot	20864407
MIRT006210	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	22484852
MIRT006210	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	22484852
MIRT006210	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	22484852
MIRT005117	hsa-miR-125a-5p	Western blot	17110380
MIRT005117	hsa-miR-125a-5p	Northern blot	17110380
MIRT003659	hsa-miR-205-5p	Reporter assay;Other	19238171
MIRT030589	hsa-miR-24-3p	Microarray	19748357
MIRT053607	hsa-miR-199a-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	23146892
MIRT002938	hsa-miR-125b-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	23146892
MIRT053647	hsa-miR-143-3p	Microarray	22942087
MIRT005117	hsa-miR-125a-5p	Western blot, qRT-PCR	23519125
MIRT002938	hsa-miR-125b-5p	Western blot, qRT-PCR	23519125
MIRT003659	hsa-miR-205-5p	Western blot, qRT-PCR	23519125
MIRT719396	hsa-miR-323b-3p	HITS-CLIP	19536157
MIRT719395	hsa-miR-5701	HITS-CLIP	19536157
MIRT719394	hsa-miR-301a-5p	HITS-CLIP	19536157
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	19536157
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	19536157
MIRT615961	hsa-miR-331-3p	HITS-CLIP	19536157
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	19536157
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	19536157
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	19536157
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	19536157
MIRT630919	hsa-miR-4328	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT030589	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT630919	hsa-miR-4328	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT630919	hsa-miR-4328	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT537657	hsa-miR-548e-5p	PAR-CLIP	22012620
MIRT065971	hsa-miR-6507-5p	PAR-CLIP	22012620
MIRT537656	hsa-miR-7109-3p	PAR-CLIP	22012620
MIRT065956	hsa-miR-33a-3p	PAR-CLIP	22012620
MIRT537655	hsa-miR-8063	PAR-CLIP	22012620
MIRT065968	hsa-miR-4698	PAR-CLIP	22012620
MIRT537654	hsa-miR-597-5p	PAR-CLIP	22012620
MIRT065961	hsa-miR-592	PAR-CLIP	22012620
MIRT065963	hsa-miR-2113	PAR-CLIP	22012620
MIRT737332	hsa-miR-17-5p	Western blotting, Immunoprecipitaion (IP), RNA-seq, qRT-PCR, In situ hybridization, ELISA	32206115
MIRT737333	hsa-miR-20a-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), RNA-seq, qRT-PCR, ELISA	32206115
MIRT719396	hsa-miR-323b-3p	HITS-CLIP	19536157
MIRT719395	hsa-miR-5701	HITS-CLIP	19536157
MIRT719394	hsa-miR-301a-5p	HITS-CLIP	19536157
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	19536157
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	19536157
MIRT615961	hsa-miR-331-3p	HITS-CLIP	19536157
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	19536157
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	19536157
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	19536157
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	19536157
MIRT630919	hsa-miR-4328	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT030589	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT630919	hsa-miR-4328	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT630919	hsa-miR-4328	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT615963	hsa-miR-6801-3p	HITS-CLIP	23824327
MIRT615962	hsa-miR-6810-3p	HITS-CLIP	23824327
MIRT615961	hsa-miR-331-3p	HITS-CLIP	23824327
MIRT615960	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT615959	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT615958	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT615957	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT615956	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT537657	hsa-miR-548e-5p	PAR-CLIP	22012620
MIRT065971	hsa-miR-6507-5p	PAR-CLIP	22012620
MIRT537656	hsa-miR-7109-3p	PAR-CLIP	22012620
MIRT065956	hsa-miR-33a-3p	PAR-CLIP	22012620
MIRT537655	hsa-miR-8063	PAR-CLIP	22012620
MIRT065968	hsa-miR-4698	PAR-CLIP	22012620
MIRT537654	hsa-miR-597-5p	PAR-CLIP	22012620
MIRT065961	hsa-miR-592	PAR-CLIP	22012620
MIRT065963	hsa-miR-2113	PAR-CLIP	22012620
MIRT967893	hsa-miR-106a	CLIP-seq
MIRT967894	hsa-miR-106b	CLIP-seq
MIRT967895	hsa-miR-1207-3p	CLIP-seq
MIRT967896	hsa-miR-1237	CLIP-seq
MIRT967897	hsa-miR-124	CLIP-seq
MIRT967898	hsa-miR-1248	CLIP-seq
MIRT967899	hsa-miR-1253	CLIP-seq
MIRT967900	hsa-miR-1255a	CLIP-seq
MIRT967901	hsa-miR-1255b	CLIP-seq
MIRT967902	hsa-miR-1257	CLIP-seq
MIRT967903	hsa-miR-125b	CLIP-seq
MIRT967904	hsa-miR-127-5p	CLIP-seq
MIRT967905	hsa-miR-1287	CLIP-seq
MIRT967906	hsa-miR-1290	CLIP-seq
MIRT967907	hsa-miR-1301	CLIP-seq
MIRT967908	hsa-miR-1343	CLIP-seq
MIRT967909	hsa-miR-135a	CLIP-seq
MIRT967910	hsa-miR-135b	CLIP-seq
MIRT967911	hsa-miR-143	CLIP-seq
MIRT967912	hsa-miR-17	CLIP-seq
MIRT967913	hsa-miR-204	CLIP-seq
MIRT967914	hsa-miR-20a	CLIP-seq
MIRT967915	hsa-miR-20b	CLIP-seq
MIRT967916	hsa-miR-211	CLIP-seq
MIRT967917	hsa-miR-2110	CLIP-seq
MIRT967918	hsa-miR-22	CLIP-seq
MIRT967919	hsa-miR-221	CLIP-seq
MIRT967920	hsa-miR-222	CLIP-seq
MIRT967921	hsa-miR-2355-5p	CLIP-seq
MIRT967922	hsa-miR-24	CLIP-seq
MIRT967923	hsa-miR-27a	CLIP-seq
MIRT967924	hsa-miR-27b	CLIP-seq
MIRT967925	hsa-miR-302a	CLIP-seq
MIRT967926	hsa-miR-302b	CLIP-seq
MIRT967927	hsa-miR-302c	CLIP-seq
MIRT967928	hsa-miR-302d	CLIP-seq
MIRT967929	hsa-miR-302e	CLIP-seq
MIRT967930	hsa-miR-3074-5p	CLIP-seq
MIRT967931	hsa-miR-3124-3p	CLIP-seq
MIRT967932	hsa-miR-3135b	CLIP-seq
MIRT967933	hsa-miR-3150a-3p	CLIP-seq
MIRT967934	hsa-miR-3153	CLIP-seq
MIRT967935	hsa-miR-3157-3p	CLIP-seq
MIRT967936	hsa-miR-3170	CLIP-seq
MIRT967937	hsa-miR-320e	CLIP-seq
MIRT967938	hsa-miR-324-5p	CLIP-seq
MIRT967939	hsa-miR-331-5p	CLIP-seq
MIRT967940	hsa-miR-345	CLIP-seq
MIRT967941	hsa-miR-3605-5p	CLIP-seq
MIRT967942	hsa-miR-3611	CLIP-seq
MIRT967943	hsa-miR-362-5p	CLIP-seq
MIRT967944	hsa-miR-3681	CLIP-seq
MIRT967945	hsa-miR-3690	CLIP-seq
MIRT967946	hsa-miR-3691-5p	CLIP-seq
MIRT967947	hsa-miR-372	CLIP-seq
MIRT967948	hsa-miR-373	CLIP-seq
MIRT967949	hsa-miR-3944-5p	CLIP-seq
MIRT967950	hsa-miR-412	CLIP-seq
MIRT967951	hsa-miR-4254	CLIP-seq
MIRT967952	hsa-miR-4256	CLIP-seq
MIRT967953	hsa-miR-4266	CLIP-seq
MIRT967954	hsa-miR-4278	CLIP-seq
MIRT967955	hsa-miR-4290	CLIP-seq
MIRT967956	hsa-miR-4319	CLIP-seq
MIRT967957	hsa-miR-4425	CLIP-seq
MIRT967958	hsa-miR-4438	CLIP-seq
MIRT967959	hsa-miR-4450	CLIP-seq
MIRT967960	hsa-miR-4477b	CLIP-seq
MIRT967961	hsa-miR-4484	CLIP-seq
MIRT967962	hsa-miR-4491	CLIP-seq
MIRT967963	hsa-miR-4503	CLIP-seq
MIRT967964	hsa-miR-4509	CLIP-seq
MIRT967965	hsa-miR-450b-5p	CLIP-seq
MIRT967966	hsa-miR-4640-3p	CLIP-seq
MIRT967967	hsa-miR-4657	CLIP-seq
MIRT967968	hsa-miR-4659a-3p	CLIP-seq
MIRT967969	hsa-miR-4659b-3p	CLIP-seq
MIRT967970	hsa-miR-4660	CLIP-seq
MIRT967971	hsa-miR-4661-5p	CLIP-seq
MIRT967972	hsa-miR-4663	CLIP-seq
MIRT967973	hsa-miR-4668-5p	CLIP-seq
MIRT967974	hsa-miR-4678	CLIP-seq
MIRT967975	hsa-miR-4695-5p	CLIP-seq
MIRT967976	hsa-miR-4699-5p	CLIP-seq
MIRT967977	hsa-miR-4708-5p	CLIP-seq
MIRT967978	hsa-miR-4713-3p	CLIP-seq
MIRT967979	hsa-miR-4716-3p	CLIP-seq
MIRT967980	hsa-miR-4729	CLIP-seq
MIRT967981	hsa-miR-4732-3p	CLIP-seq
MIRT967982	hsa-miR-4744	CLIP-seq
MIRT967983	hsa-miR-4752	CLIP-seq
MIRT967984	hsa-miR-4753-3p	CLIP-seq
MIRT967985	hsa-miR-4755-5p	CLIP-seq
MIRT967986	hsa-miR-4769-3p	CLIP-seq
MIRT967987	hsa-miR-4770	CLIP-seq
MIRT967988	hsa-miR-4779	CLIP-seq
MIRT967989	hsa-miR-4790-3p	CLIP-seq
MIRT967990	hsa-miR-4793-5p	CLIP-seq
MIRT967991	hsa-miR-4794	CLIP-seq
MIRT967992	hsa-miR-4796-3p	CLIP-seq
MIRT967993	hsa-miR-4799-5p	CLIP-seq
MIRT967994	hsa-miR-500b	CLIP-seq
MIRT967995	hsa-miR-5047	CLIP-seq
MIRT967996	hsa-miR-506	CLIP-seq
MIRT967997	hsa-miR-507	CLIP-seq
MIRT967998	hsa-miR-5095	CLIP-seq
MIRT967999	hsa-miR-511	CLIP-seq
MIRT968000	hsa-miR-512-3p	CLIP-seq
MIRT968001	hsa-miR-513a-5p	CLIP-seq
MIRT968002	hsa-miR-519a	CLIP-seq
MIRT968003	hsa-miR-519b-3p	CLIP-seq
MIRT968004	hsa-miR-519c-3p	CLIP-seq
MIRT968005	hsa-miR-519d	CLIP-seq
MIRT968006	hsa-miR-520a-3p	CLIP-seq
MIRT968007	hsa-miR-520b	CLIP-seq
MIRT968008	hsa-miR-520c-3p	CLIP-seq
MIRT968009	hsa-miR-520d-3p	CLIP-seq
MIRT968010	hsa-miR-520e	CLIP-seq
MIRT968011	hsa-miR-548al	CLIP-seq
MIRT968012	hsa-miR-548an	CLIP-seq
MIRT968013	hsa-miR-548n	CLIP-seq
MIRT968014	hsa-miR-548t	CLIP-seq
MIRT968015	hsa-miR-557	CLIP-seq
MIRT968016	hsa-miR-580	CLIP-seq
MIRT968017	hsa-miR-584	CLIP-seq
MIRT968018	hsa-miR-597	CLIP-seq
MIRT968019	hsa-miR-599	CLIP-seq
MIRT968020	hsa-miR-623	CLIP-seq
MIRT968021	hsa-miR-635	CLIP-seq
MIRT968022	hsa-miR-670	CLIP-seq
MIRT968023	hsa-miR-874	CLIP-seq
MIRT968024	hsa-miR-93	CLIP-seq
MIRT1922720	hsa-miR-561	CLIP-seq
MIRT967893	hsa-miR-106a	CLIP-seq
MIRT967894	hsa-miR-106b	CLIP-seq
MIRT1986755	hsa-miR-1200	CLIP-seq
MIRT967896	hsa-miR-1237	CLIP-seq
MIRT1986756	hsa-miR-1238	CLIP-seq
MIRT1986757	hsa-miR-1245	CLIP-seq
MIRT1986758	hsa-miR-1271	CLIP-seq
MIRT1986759	hsa-miR-1285	CLIP-seq
MIRT967906	hsa-miR-1290	CLIP-seq
MIRT967911	hsa-miR-143	CLIP-seq
MIRT1986760	hsa-miR-145	CLIP-seq
MIRT1986761	hsa-miR-150	CLIP-seq
MIRT967912	hsa-miR-17	CLIP-seq
MIRT1986762	hsa-miR-198	CLIP-seq
MIRT967913	hsa-miR-204	CLIP-seq
MIRT1986763	hsa-miR-205	CLIP-seq
MIRT967914	hsa-miR-20a	CLIP-seq
MIRT967915	hsa-miR-20b	CLIP-seq
MIRT967916	hsa-miR-211	CLIP-seq
MIRT1986764	hsa-miR-219-2-3p	CLIP-seq
MIRT967922	hsa-miR-24	CLIP-seq
MIRT967925	hsa-miR-302a	CLIP-seq
MIRT967926	hsa-miR-302b	CLIP-seq
MIRT967927	hsa-miR-302c	CLIP-seq
MIRT967928	hsa-miR-302d	CLIP-seq
MIRT967929	hsa-miR-302e	CLIP-seq
MIRT1986765	hsa-miR-3120-5p	CLIP-seq
MIRT967931	hsa-miR-3124-3p	CLIP-seq
MIRT1986766	hsa-miR-3130-3p	CLIP-seq
MIRT1986767	hsa-miR-3130-5p	CLIP-seq
MIRT967934	hsa-miR-3153	CLIP-seq
MIRT1986768	hsa-miR-3182	CLIP-seq
MIRT1986769	hsa-miR-3187-5p	CLIP-seq
MIRT967938	hsa-miR-324-5p	CLIP-seq
MIRT1986770	hsa-miR-338-5p	CLIP-seq
MIRT1986771	hsa-miR-3675-3p	CLIP-seq
MIRT1986772	hsa-miR-3689a-3p	CLIP-seq
MIRT1986773	hsa-miR-3689c	CLIP-seq
MIRT967945	hsa-miR-3690	CLIP-seq
MIRT967947	hsa-miR-372	CLIP-seq
MIRT967948	hsa-miR-373	CLIP-seq
MIRT1986774	hsa-miR-378g	CLIP-seq
MIRT1986775	hsa-miR-3925-3p	CLIP-seq
MIRT1986776	hsa-miR-4252	CLIP-seq
MIRT967951	hsa-miR-4254	CLIP-seq
MIRT1986777	hsa-miR-4276	CLIP-seq
MIRT1986778	hsa-miR-4277	CLIP-seq
MIRT1986779	hsa-miR-4287	CLIP-seq
MIRT1986780	hsa-miR-4314	CLIP-seq
MIRT1986781	hsa-miR-4324	CLIP-seq
MIRT1986782	hsa-miR-4433	CLIP-seq
MIRT1986783	hsa-miR-4437	CLIP-seq
MIRT967958	hsa-miR-4438	CLIP-seq
MIRT1986784	hsa-miR-4464	CLIP-seq
MIRT967960	hsa-miR-4477b	CLIP-seq
MIRT1986785	hsa-miR-4482	CLIP-seq
MIRT1986786	hsa-miR-4486	CLIP-seq
MIRT1986787	hsa-miR-4502	CLIP-seq
MIRT967963	hsa-miR-4503	CLIP-seq
MIRT967965	hsa-miR-450b-5p	CLIP-seq
MIRT967966	hsa-miR-4640-3p	CLIP-seq
MIRT1986788	hsa-miR-4645-3p	CLIP-seq
MIRT1986789	hsa-miR-4674	CLIP-seq
MIRT1986790	hsa-miR-4685-3p	CLIP-seq
MIRT1986791	hsa-miR-4691-5p	CLIP-seq
MIRT967977	hsa-miR-4708-5p	CLIP-seq
MIRT1986792	hsa-miR-4720-3p	CLIP-seq
MIRT1986793	hsa-miR-4728-5p	CLIP-seq
MIRT1986794	hsa-miR-4735-5p	CLIP-seq
MIRT1986795	hsa-miR-4748	CLIP-seq
MIRT967984	hsa-miR-4753-3p	CLIP-seq
MIRT967985	hsa-miR-4755-5p	CLIP-seq
MIRT967987	hsa-miR-4770	CLIP-seq
MIRT1986796	hsa-miR-4775	CLIP-seq
MIRT1986797	hsa-miR-4778-3p	CLIP-seq
MIRT967990	hsa-miR-4793-5p	CLIP-seq
MIRT1986798	hsa-miR-4804-3p	CLIP-seq
MIRT1986799	hsa-miR-500a	CLIP-seq
MIRT967997	hsa-miR-507	CLIP-seq
MIRT967998	hsa-miR-5095	CLIP-seq
MIRT967999	hsa-miR-511	CLIP-seq
MIRT968000	hsa-miR-512-3p	CLIP-seq
MIRT968002	hsa-miR-519a	CLIP-seq
MIRT968003	hsa-miR-519b-3p	CLIP-seq
MIRT968004	hsa-miR-519c-3p	CLIP-seq
MIRT968005	hsa-miR-519d	CLIP-seq
MIRT968006	hsa-miR-520a-3p	CLIP-seq
MIRT968007	hsa-miR-520b	CLIP-seq
MIRT968008	hsa-miR-520c-3p	CLIP-seq
MIRT968009	hsa-miR-520d-3p	CLIP-seq
MIRT968010	hsa-miR-520e	CLIP-seq
MIRT1986800	hsa-miR-520g	CLIP-seq
MIRT1986801	hsa-miR-520h	CLIP-seq
MIRT1986802	hsa-miR-526b	CLIP-seq
MIRT1986803	hsa-miR-544b	CLIP-seq
MIRT1986804	hsa-miR-548ae	CLIP-seq
MIRT1986805	hsa-miR-548aj	CLIP-seq
MIRT1986806	hsa-miR-548am	CLIP-seq
MIRT1986807	hsa-miR-548x	CLIP-seq
MIRT968015	hsa-miR-557	CLIP-seq
MIRT968019	hsa-miR-599	CLIP-seq
MIRT1986808	hsa-miR-612	CLIP-seq
MIRT1986809	hsa-miR-622	CLIP-seq
MIRT968020	hsa-miR-623	CLIP-seq
MIRT1986810	hsa-miR-665	CLIP-seq
MIRT1986811	hsa-miR-766	CLIP-seq
MIRT968024	hsa-miR-93	CLIP-seq
MIRT1986812	hsa-miR-96	CLIP-seq
MIRT967893	hsa-miR-106a	CLIP-seq
MIRT967894	hsa-miR-106b	CLIP-seq
MIRT967895	hsa-miR-1207-3p	CLIP-seq
MIRT967896	hsa-miR-1237	CLIP-seq
MIRT967897	hsa-miR-124	CLIP-seq
MIRT967898	hsa-miR-1248	CLIP-seq
MIRT967899	hsa-miR-1253	CLIP-seq
MIRT2221329	hsa-miR-1256	CLIP-seq
MIRT1986758	hsa-miR-1271	CLIP-seq
MIRT967906	hsa-miR-1290	CLIP-seq
MIRT967911	hsa-miR-143	CLIP-seq
MIRT1986761	hsa-miR-150	CLIP-seq
MIRT967912	hsa-miR-17	CLIP-seq
MIRT2221330	hsa-miR-185	CLIP-seq
MIRT967913	hsa-miR-204	CLIP-seq
MIRT967914	hsa-miR-20a	CLIP-seq
MIRT967915	hsa-miR-20b	CLIP-seq
MIRT967916	hsa-miR-211	CLIP-seq
MIRT967918	hsa-miR-22	CLIP-seq
MIRT967922	hsa-miR-24	CLIP-seq
MIRT967923	hsa-miR-27a	CLIP-seq
MIRT967924	hsa-miR-27b	CLIP-seq
MIRT2221331	hsa-miR-297	CLIP-seq
MIRT967925	hsa-miR-302a	CLIP-seq
MIRT967926	hsa-miR-302b	CLIP-seq
MIRT967927	hsa-miR-302c	CLIP-seq
MIRT967928	hsa-miR-302d	CLIP-seq
MIRT967929	hsa-miR-302e	CLIP-seq
MIRT967931	hsa-miR-3124-3p	CLIP-seq
MIRT2221332	hsa-miR-3150a-5p	CLIP-seq
MIRT2221333	hsa-miR-3150b-5p	CLIP-seq
MIRT967934	hsa-miR-3153	CLIP-seq
MIRT2221334	hsa-miR-3185	CLIP-seq
MIRT2221335	hsa-miR-3192	CLIP-seq
MIRT2221336	hsa-miR-3199	CLIP-seq
MIRT967938	hsa-miR-324-5p	CLIP-seq
MIRT1986770	hsa-miR-338-5p	CLIP-seq
MIRT967942	hsa-miR-3611	CLIP-seq
MIRT2221337	hsa-miR-3649	CLIP-seq
MIRT2221338	hsa-miR-3661	CLIP-seq
MIRT2221339	hsa-miR-3662	CLIP-seq
MIRT1986772	hsa-miR-3689a-3p	CLIP-seq
MIRT1986773	hsa-miR-3689c	CLIP-seq
MIRT967945	hsa-miR-3690	CLIP-seq
MIRT967947	hsa-miR-372	CLIP-seq
MIRT967948	hsa-miR-373	CLIP-seq
MIRT2221340	hsa-miR-3915	CLIP-seq
MIRT2221341	hsa-miR-3924	CLIP-seq
MIRT2221342	hsa-miR-3928	CLIP-seq
MIRT967950	hsa-miR-412	CLIP-seq
MIRT967951	hsa-miR-4254	CLIP-seq
MIRT2221343	hsa-miR-4261	CLIP-seq
MIRT2221344	hsa-miR-4306	CLIP-seq
MIRT1986782	hsa-miR-4433	CLIP-seq
MIRT967958	hsa-miR-4438	CLIP-seq
MIRT967961	hsa-miR-4484	CLIP-seq
MIRT1986787	hsa-miR-4502	CLIP-seq
MIRT967963	hsa-miR-4503	CLIP-seq
MIRT967964	hsa-miR-4509	CLIP-seq
MIRT967965	hsa-miR-450b-5p	CLIP-seq
MIRT2221345	hsa-miR-4515	CLIP-seq
MIRT2221346	hsa-miR-4517	CLIP-seq
MIRT2221347	hsa-miR-4642	CLIP-seq
MIRT2221348	hsa-miR-4644	CLIP-seq
MIRT2221349	hsa-miR-4646-5p	CLIP-seq
MIRT967968	hsa-miR-4659a-3p	CLIP-seq
MIRT967969	hsa-miR-4659b-3p	CLIP-seq
MIRT967971	hsa-miR-4661-5p	CLIP-seq
MIRT967972	hsa-miR-4663	CLIP-seq
MIRT967973	hsa-miR-4668-5p	CLIP-seq
MIRT967977	hsa-miR-4708-5p	CLIP-seq
MIRT2221350	hsa-miR-4727-5p	CLIP-seq
MIRT1986793	hsa-miR-4728-5p	CLIP-seq
MIRT967982	hsa-miR-4744	CLIP-seq
MIRT967985	hsa-miR-4755-5p	CLIP-seq
MIRT967986	hsa-miR-4769-3p	CLIP-seq
MIRT967987	hsa-miR-4770	CLIP-seq
MIRT2221351	hsa-miR-4789-3p	CLIP-seq
MIRT967990	hsa-miR-4793-5p	CLIP-seq
MIRT2221352	hsa-miR-492	CLIP-seq
MIRT1986799	hsa-miR-500a	CLIP-seq
MIRT967996	hsa-miR-506	CLIP-seq
MIRT967997	hsa-miR-507	CLIP-seq
MIRT967998	hsa-miR-5095	CLIP-seq
MIRT968000	hsa-miR-512-3p	CLIP-seq
MIRT968001	hsa-miR-513a-5p	CLIP-seq
MIRT2221353	hsa-miR-515-3p	CLIP-seq
MIRT968002	hsa-miR-519a	CLIP-seq
MIRT968003	hsa-miR-519b-3p	CLIP-seq
MIRT968004	hsa-miR-519c-3p	CLIP-seq
MIRT968005	hsa-miR-519d	CLIP-seq
MIRT2221354	hsa-miR-519e	CLIP-seq
MIRT968006	hsa-miR-520a-3p	CLIP-seq
MIRT968007	hsa-miR-520b	CLIP-seq
MIRT968008	hsa-miR-520c-3p	CLIP-seq
MIRT968009	hsa-miR-520d-3p	CLIP-seq
MIRT968010	hsa-miR-520e	CLIP-seq
MIRT1986800	hsa-miR-520g	CLIP-seq
MIRT1986801	hsa-miR-520h	CLIP-seq
MIRT1986804	hsa-miR-548ae	CLIP-seq
MIRT1986805	hsa-miR-548aj	CLIP-seq
MIRT1986806	hsa-miR-548am	CLIP-seq
MIRT968012	hsa-miR-548an	CLIP-seq
MIRT1986807	hsa-miR-548x	CLIP-seq
MIRT2221355	hsa-miR-550a	CLIP-seq
MIRT968015	hsa-miR-557	CLIP-seq
MIRT2221356	hsa-miR-567	CLIP-seq
MIRT2221357	hsa-miR-578	CLIP-seq
MIRT968019	hsa-miR-599	CLIP-seq
MIRT2221358	hsa-miR-617	CLIP-seq
MIRT968020	hsa-miR-623	CLIP-seq
MIRT2221359	hsa-miR-631	CLIP-seq
MIRT1986810	hsa-miR-665	CLIP-seq
MIRT968024	hsa-miR-93	CLIP-seq
MIRT1986812	hsa-miR-96	CLIP-seq
MIRT967893	hsa-miR-106a	CLIP-seq
MIRT967894	hsa-miR-106b	CLIP-seq
MIRT967912	hsa-miR-17	CLIP-seq
MIRT967914	hsa-miR-20a	CLIP-seq
MIRT967915	hsa-miR-20b	CLIP-seq
MIRT968005	hsa-miR-519d	CLIP-seq
MIRT968024	hsa-miR-93	CLIP-seq
MIRT1922720	hsa-miR-561	CLIP-seq
MIRT967893	hsa-miR-106a	CLIP-seq
MIRT967894	hsa-miR-106b	CLIP-seq
MIRT967912	hsa-miR-17	CLIP-seq
MIRT967914	hsa-miR-20a	CLIP-seq
MIRT967915	hsa-miR-20b	CLIP-seq
MIRT967925	hsa-miR-302a	CLIP-seq
MIRT967926	hsa-miR-302b	CLIP-seq
MIRT967927	hsa-miR-302c	CLIP-seq
MIRT967928	hsa-miR-302d	CLIP-seq
MIRT967929	hsa-miR-302e	CLIP-seq
MIRT967947	hsa-miR-372	CLIP-seq
MIRT967948	hsa-miR-373	CLIP-seq
MIRT967958	hsa-miR-4438	CLIP-seq
MIRT967972	hsa-miR-4663	CLIP-seq
MIRT967998	hsa-miR-5095	CLIP-seq
MIRT968000	hsa-miR-512-3p	CLIP-seq
MIRT968005	hsa-miR-519d	CLIP-seq
MIRT968006	hsa-miR-520a-3p	CLIP-seq
MIRT968007	hsa-miR-520b	CLIP-seq
MIRT968008	hsa-miR-520c-3p	CLIP-seq
MIRT968009	hsa-miR-520d-3p	CLIP-seq
MIRT968010	hsa-miR-520e	CLIP-seq
MIRT1986800	hsa-miR-520g	CLIP-seq
MIRT1986801	hsa-miR-520h	CLIP-seq
MIRT968024	hsa-miR-93	CLIP-seq
MIRT2524974	hsa-miR-203	CLIP-seq
MIRT2524974	hsa-miR-203	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Activation	21741601
TWIST1	Repression	19051271
TWIST2	Repression	19051271
YBX1	Activation	19648825

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003197	Process	Endocardial cushion development	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	7556068
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	ISS	7514177
GO:0005515	Function	Protein binding	IPI	7556068, 7592681, 9516479, 10572067, 15282549, 16273093, 16832058, 16843263, 17148612, 17426253, 19411071, 20007781, 20227043, 21075308, 21203579, 21278786, 22439932, 22733765, 22806884, 22939624, 23436906, 23611113, 23680147, 23688700, 23866081, 24189400, 24557338, 24658140, 252417
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	11389077
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2687875, 17701904
GO:0007162	Process	Negative regulation of cell adhesion	IDA	7556068
GO:0007165	Process	Signal transduction	IDA	10572067
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IDA	7556068
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	ISS	7514177
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007422	Process	Peripheral nervous system development	IEA
GO:0007422	Process	Peripheral nervous system development	ISS
GO:0007507	Process	Heart development	ISS
GO:0009925	Component	Basal plasma membrane	IBA
GO:0009968	Process	Negative regulation of signal transduction	IDA	11389077
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0014037	Process	Schwann cell differentiation	IEA
GO:0014037	Process	Schwann cell differentiation	ISS
GO:0014044	Process	Schwann cell development	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	12646923
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019838	Function	Growth factor binding	IPI	11389077
GO:0019838	Function	Growth factor binding	ISS	7514177
GO:0021545	Process	Cranial nerve development	IEA
GO:0021545	Process	Cranial nerve development	ISS
GO:0030182	Process	Neuron differentiation	IBA
GO:0030296	Function	Protein tyrosine kinase activator activity	IDA	7556068
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	27353365
GO:0038023	Function	Signaling receptor activity	IEA
GO:0038131	Function	Neuregulin receptor activity	IBA
GO:0038131	Function	Neuregulin receptor activity	IEA
GO:0038132	Function	Neuregulin binding	IBA
GO:0038132	Function	Neuregulin binding	IDA	20682778
GO:0038133	Process	ERBB2-ERBB3 signaling pathway	IEA
GO:0038143	Component	ERBB3:ERBB2 complex	IDA	12000754
GO:0042060	Process	Wound healing	NAS	12646923
GO:0042127	Process	Regulation of cell population proliferation	IDA	11389077
GO:0042552	Process	Myelination	IEA
GO:0042802	Function	Identical protein binding	IPI	21575594, 23436906
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043125	Function	ErbB-3 class receptor binding	IPI	12000754
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043235	Component	Receptor complex	IEA
GO:0043235	Component	Receptor complex	ISS	7514177
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	7556068
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0046982	Function	Protein heterodimerization activity	IPI	7556068
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IBA
GO:0051048	Process	Negative regulation of secretion	IDA	10559227
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051402	Process	Neuron apoptotic process	IMP	17701904
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	TAS	17701904
GO:0055025	Process	Positive regulation of cardiac muscle tissue development	IEA
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IEA
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IMP	17701904
GO:2000672	Process	Negative regulation of motor neuron apoptotic process	IEA

Other IDs

• MIM: 190151
• HGNC: 3431
• e!Ensembl: ENSG00000065361

Protein

• UniProt ID: P21860
• Protein name: Receptor tyrosine-protein kinase erbB-3 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-3) (Tyrosine kinase-type cell surface receptor HER3)
• Protein function: Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with t
• PDB: 1M6B, 2L9U, 3KEX, 3LMG, 3P11, 4LEO, 4P59, 4RIW, 4RIX, 4RIY, 5CUS, 5O4O, 5O7P, 6KBI, 6OP9, 7BHE, 7BHF, 7D85, 7MN5, 7MN6, 7MN8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01030	Recep_L_domain	55 → 167	Receptor L domain	Repeat
  PF00757	Furin-like	169 → 332	Furin-like cysteine rich region	Domain
  PF01030	Recep_L_domain	353 → 474	Receptor L domain	Repeat
  PF14843	GF_recep_IV	499 → 630	Growth factor receptor domain IV	Domain
  PF07714	PK_Tyr_Ser-Thr	709 → 965	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Epithelial tissues and brain.
• Sequence:

  MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
  GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
  LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
  RSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
  TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
  CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
  LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
  RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
  RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
  REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
  YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
  GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
  GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
  SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
  LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
  VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
  LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED
  NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR
  PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL
  TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
  NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY
  EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD
  SAFDNPDYWHSRLFPKANAQRT

• Sequence length: 1342

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Proteoglycans in cancer
MicroRNAs in cancer

Reactome:

Signaling by ERBB2
Signaling by ERBB4
SHC1 events in ERBB2 signaling
PIP3 activates AKT signaling
GRB7 events in ERBB2 signaling
Downregulation of ERBB2:ERBB3 signaling
PI3K events in ERBB2 signaling
Constitutive Signaling by Aberrant PI3K in Cancer
RAF/MAP kinase cascade
ERBB2 Regulates Cell Motility
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
ERBB2 Activates PTK6 Signaling
Downregulation of ERBB2 signaling
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 TMD/JMD mutants

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
ERBB3-related disorder	Likely pathogenic	rs771935902, rs2540758459	RCV003410370 RCV003405841	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lethal congenital contracture syndrome 2	Likely pathogenic	rs1565859132, rs762129530, rs141230043	RCV000013400 RCV003388436 RCV001257435	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malignant tumor of urinary bladder	Pathogenic	rs146486757, rs2136822757, rs2540742315, rs1057519893	RCV003332947 RCV003332948 RCV003332988 RCV003332171	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic	rs1057519893	RCV004668943	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Visceral neuropathy, familial, 1, autosomal recessive	Pathogenic; Likely pathogenic	rs1869082532, rs2136818517, rs2136822199, rs2136815265, rs766102716	RCV001799810 RCV001799811 RCV001799812 RCV003313825 RCV003313826	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EATING DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Embryonal rhabdomyosarcoma	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erythroleukemia, familial, susceptibility to	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLBLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL PSEUDO-OBSTRUCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lethal congenital contracture syndrome 1	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LETHAL CONGENITAL CONTRACTURE SYNDROME TYPE 2	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Visceral neuropathy, familial	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	16432850, 18199957, 22222570		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	12021921, 15150091, 23958847, 31607147		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10782893, 12618754, 17266032, 17631905, 25019985		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17631905		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	24151090, 26844548		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	10782893		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	15688028, 18404164, 21387307, 24419753, 25501131, 25596284, 26824984, 29366790, 29473311, 31357969		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20647770		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	8669836		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19401448, 26367378		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	26320593		★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	26011570	Associate	★☆☆☆☆ Found in Text Mining only
Akinesia	Akinesia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	GWASCAT_DG	25608926		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	23227212		★☆☆☆☆ Found in Text Mining only
Amblyopia	Amblyopia	Pubtator	31752936	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	23278525		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	16848681		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	31752936	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30882895		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19956108	Associate	★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	17701904		★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	HPO_DG			★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	29785011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	32700739	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	LHGDN	16896310		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19017278	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22069271, 25530448		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	35437997	Associate	★☆☆☆☆ Found in Text Mining only
Benign neoplasm of bladder	Benign Neoplasm Of Bladder	CGI_DG			★☆☆☆☆ Found in Text Mining only
Benign neoplasm of stomach	Benign Neoplasm Of Stomach	CGI_DG			★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	30335866		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	30335866, 37341068	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	22989054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22989054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16685269		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23333248, 24467768, 27906180, 29434875		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	23541807		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	16896310		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	20604919, 23224376	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	14739033		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10205169, 10383144, 10473632, 10797306, 16482517, 17110380, 17145873, 1715580, 17163417, 18270579, 18283314, 18409071, 18425425, 18454306, 18625725, 18632642, 18985033, 19276373, 19435893, 19481955, 20103628, 20498641, 20604919, 20661224, 21396094, 21482676, 21638049, 21725367, 21951604, 22262199, 22301547, 22492965, 22627808, 22703232, 23062209, 23099884, 23224399, 23378579, 23436906, 23519125, 23999432, 24168763, 24692179, 24706460, 24711549, 25046105, 25174405, 25241146, 25248370, 25516216, 25519010, 25668816, 25849870, 25961924, 25983297, 26148232, 26261492, 26581908, 26621843, 27185877, 27351228, 27389555, 27474152, 28036286, 28114269, 28369073, 28539475, 28680745, 28797930, 28873009, 28963699, 28978022, 29059433, 29127433, 29233126, 29409974, 29413684, 29437790, 29499944, 29501698, 29715459, 29963236, 30068375, 30367623, 30556879, 30639369, 31531954, 31555351, 7607571, 8045292, 8247542, 8764133, 9788438, 9823984		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21638049, 28114269		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10473632, 10735500, 11692142, 12853564, 1333787, 14602723, 15084248, 15770691, 16428439, 17110380, 1715580, 17201160, 17376931, 17465220, 17661082, 17983482, 18182100, 18270579, 18283314, 18355957, 18409071, 18434311, 18625725, 18985033, 19330842, 19435893, 20516217, 20604919, 21042418, 21396094, 21492444, 21884573, 21939528, 22301547, 22848366, 23062209, 23320098, 23519125, 23937725, 23959396, 24165569, 24346286, 24409301, 24519943, 24692179, 24706169, 24747692, 25017122, 25630670, 25953157, 25983297, 26011570, 26181203, 26317614, 26496879, 26581908, 26716646, 27035903, 27185877, 27223437, 27351228, 27452985, 27618787, 28369073, 28750640, 29349598, 30068375, 30071039, 30367623, 30556879, 30657766, 31792349, 32365829, 33086721, 33494385, 33663941, 33692466, 34010730, 35007696, 35503762, 35806132, 35933367, 37200287, 37801674, 39794693, 8524214, 8536273, 8688326, 9823984	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	33964913	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	29453410	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20462431, 21407808, 35177646, 35484888, 35581263, 37200287	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10640836, 12618754, 15254961, 15782071, 15908515, 26296355, 27080337, 27913862, 28600476, 29556616, 31752936, 7847801, 9494565, 9823984		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	27514687	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	18507044, 30173251	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	9823984	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11355950, 26000702, 26595522, 26846102, 27514687, 28800792, 32515546, 34400880	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	29473311	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of bladder	Bladder carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of stomach	Stomach Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26496879	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	9823984	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	35477749	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	9823984	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	18507044	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	30335866		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23333248, 24467768, 27906180, 29434875		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10918604, 14739033, 17631905, 21387307, 21847121, 22484852, 23060569, 24469108, 26678909, 26689995, 26988096, 28000159, 28350117, 29473311, 29959202, 30314880, 30831376, 31416841, 31790894, 7607571		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26482609, 31328457	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23918833, 27259358	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38276060	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17465227, 19648825, 28423512	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18507044	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	18507044, 30173251		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10961689, 19737968, 20227043, 21364581, 25026212, 26482609, 27913862, 29286064, 30588099, 30949858, 31328457, 31728045, 9681822		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	37530323	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	16401639		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26125746, 30127948, 31078911		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	19367286, 26125746, 30127948, 31078911		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	LHGDN	16307437		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease, Type Ia (disorder)	Charcot-Marie-Tooth disease	BEFREE	16307437		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23052372, 24563076, 30335866	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	30322893	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	10831347		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	16896310		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	15150091, 22045652		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	LHGDN	16867224		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	15360049		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15741050, 16053920, 19690388, 22142822, 22485250, 24685132, 24970817, 26160848, 30212974, 31736063, 9712416		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10686540, 16507107, 35484888	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	22142822		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CLINVAR_DG	23680147		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19690388, 21212430, 24300455, 24867101, 24909266, 25017791, 25739551, 25915155, 26287187, 26367378, 26935861, 27906435, 28032592, 29075780, 29338072, 29413684, 29718453, 29963236, 30212974, 30650638, 31395690, 31402949, 31426807, 31488078, 31724799, 9712416		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12571082, 16127743, 1715580, 21212430, 22112971, 23301758, 24205104, 24867101, 24970817, 25915155, 25943333, 26287187, 26367378, 27447549, 27906435, 28032592, 29024937, 29075780, 29254887, 29338072, 29718453, 31488078, 31736063, 32319604, 35484888, 35902718, 36862005, 37097008, 37302522	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	21212430		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	9823984		★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	10831347		★☆☆☆☆ Found in Text Mining only
Congenital contracture	Congenital contracture	BEFREE	31752936		★☆☆☆☆ Found in Text Mining only
Contracture	Contracture	Pubtator	31752936	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15360049		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28162790		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	25990246	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative vitreoretinopathy	Degenerative vitreoretinopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Deglutition disorder	Pubtator	34001187	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	27044931	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	26320593		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	31752936	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30927244		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26320593, 30927244		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19956108, 20668683, 21270831, 21850031, 21873553, 25422107, 26513234, 28597949, 33083497, 34448034, 35594935, 38453145	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	17554260, 17554300, 18978792, 19430480, 21829393		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17554260, 17554300, 18978792, 19430480		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18462017, 18940880, 19956108, 20668683, 20962850, 21850031, 21873553, 22932816, 23539116, 26450151, 26513234, 29109006, 31467911, 31808541		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30927244		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	21873553		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26245339		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	35594935, 39719581	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	27074567, 29254887	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	18024331		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	7992839, 9823984		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	22854050, 33086721, 37460683	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18829572		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18334972, 23028188	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	22606320	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	35437997	Stimulate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21364581, 26482609, 31328457		★☆☆☆☆ Found in Text Mining only
Erythroid hyperplasia	Erythroid hyperplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10512940, 8286103		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10512940		★☆☆☆☆ Found in Text Mining only
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	20498641		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	27074567	Associate	★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24927194		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	24151090		★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	26806567	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	18231572		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28285962, 29954840, 30335866		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	CTD_human_DG	24997986		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	30335866, 33563892	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	23835063		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	23835063		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26844548		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	27559738	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19331154	Associate	★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	10831347		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	10831347		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16896310, 20467331, 21439954, 22745588, 31567312		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20467331, 33892666, 34320350, 35255831	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16896310, 20467331, 21439954, 22745588, 29888103, 31567312		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15148612, 26088461, 7760096		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15812817, 26612725, 33892666	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23998444, 26195293, 27986750, 29440171, 30694565, 8286103		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20443891, 21840482, 26195293, 32381551	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	8286103		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	31819021	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28235789	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	26581908	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18698037, 21622572	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Motor and Sensory Neuropathy Type I	Hereditary motor and sensory neuropathy	BEFREE	16307437		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	26287187	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	39199380	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hydatidiform Mole, Partial	Hydatidiform Mole	BEFREE	10831347		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	22350758		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23301758	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26205780, 26515145, 29603584, 36244759	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	26320593		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32426915	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	18490922, 19530240		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30720051		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	24886365, 26496879, 27196778, 27663569		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11779863	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	19690388		★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal perforation	Pubtator	22606320	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	BEFREE	31400925		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	8732665		★☆☆☆☆ Found in Text Mining only
Jeune syndrome	Jeune syndrome	Pubtator	25996847	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	8286103		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	26287187	Associate	★☆☆☆☆ Found in Text Mining only
LETHAL CONGENITAL CONTRACTURE SYNDROME 1	Lethal Congenital Contracture Syndrome	BEFREE	17701898		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lethal Congenital Contracture Syndrome 2	Lethal Congenital Contracture Syndrome	GENOMICS_ENGLAND_DG	12519750, 17709104		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lethal Congenital Contracture Syndrome 2	Lethal Congenital Contracture Syndrome	ORPHANET_DG	17701904		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lethal Congenital Contracture Syndrome 2	Lethal congenital contracture syndrome	Pubtator	17701904	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lethal Congenital Contracture Syndrome 2	Lethal Congenital Contracture Syndrome	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lethal congenital contracture syndrome type 2	Lethal Congenital Contracture Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	22510010		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26000702, 27514687, 28800792, 30154664		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12483526, 17463250, 17627612		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	12483526		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	17627612, 20351256, 21847121, 24913497, 26689995, 29473311, 32170048, 32535106, 33619172, 34548309, 35302851, 36086904, 37302522, 40174661	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	25249545, 25596284		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	1333787	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35902718, 38144565	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	22989054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22989054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	26195293, 27986750, 29440171, 30694565, 8286103		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10205169, 10383144, 10797306, 16168116, 16482517, 17110380, 17145873, 17163417, 18270579, 18283314, 18404164, 18409071, 18425425, 18454306, 18625725, 18632642, 18985033, 19276373, 19435893, 19481955, 19826038, 20103628, 20498641, 20604919, 20661224, 21396094, 21482676, 21638049, 21725367, 21951604, 22262199, 22492965, 22627808, 22703232, 23062209, 23099884, 23224399, 23378579, 23436906, 23519125, 23999432, 24168763, 24692179, 24706460, 24711549, 25046105, 25174405, 25241146, 25248370, 25516216, 25519010, 25668816, 25849870, 25953157, 25961924, 25983297, 26148232, 26261492, 26581908, 26621843, 26860947, 27185877, 27351228, 27389555, 27452985, 27474152, 28036286, 28114269, 28369073, 28539475, 28680745, 28750640, 28797930, 28873009, 28963699, 28978022, 29059433, 29127433, 29233126, 29409974, 29437790, 29499944, 29501698, 29715459, 29963236, 30068375, 30092835, 30317526, 30367623, 30556879, 30639369, 31531954, 31555351, 7607571, 8764133, 9788438, 9823984		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21638049, 28114269		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10512940		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	CTD_human_DG	24997986		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28285962, 30335866		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	26619359		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10918604, 14739033, 17631905, 21387307, 21847121, 22484852, 23060569, 24469108, 24520092, 26678909, 26689995, 26988096, 28000159, 28350117, 28656214, 29413684, 29473311, 29959202, 30314880, 30831376, 31416841, 31619200, 31790894, 7607571		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	12483526		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10961689, 19737968, 20227043, 21364581, 22856597, 25026212, 27913862, 29286064, 30588099, 30949858, 31328457, 31728045, 9681822		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	1361525, 17457047, 19304440, 20647770, 20726858, 22067729, 26109364, 27871278, 29549161, 29935372, 30882895, 30961642		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	27986750		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15141384, 16675564, 18490922, 18852121, 20587519, 27191720		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17634423		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	26194695		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12618754, 23445612, 23680147, 24909266, 25400108, 25455899, 26942872, 27787520, 28399526, 28573357, 28899363, 28924391, 29233126, 30621788, 30726523, 30915908, 31484705		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	15809707		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23333248, 24467768, 27906180, 29434875		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10022808, 10782893, 11206334, 11369513, 11568571, 11859873, 12618754, 1361525, 15466203, 17292332, 17465220, 17667926, 18404164, 18454306, 18490922, 18507044, 18575766, 19497323, 19530240, 19659570, 19690388, 19737968, 20179223, 20467331, 20816829, 21057539, 22213458, 22301547, 22856597, 23146892, 23313199, 23320098, 23342251, 23395887, 23698633, 24519943, 24520092, 24862757, 24886126, 24970817, 25400118, 25410594, 25742786, 26116360, 26195293, 26367378, 26482609, 26496898, 26880266, 27070783, 27325685, 27474152, 27514687, 27517321, 27986750, 28000159, 28230065, 28235665, 28248115, 28507002, 28680745, 28791648, 28805349, 28889394, 28899363, 29039474, 29179520, 29413684, 29437790, 29440171, 29760043, 29963236, 30076717, 30109175, 30115691, 30523157, 30832342, 30949858, 31400925, 31519989, 31615015, 31619200, 31846731, 8464905, 8669836, 9712416		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26125746, 30127948, 31078911		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15741050, 16053920, 19690388, 22142822, 22485250, 24685132, 24970817, 26160848, 29312543, 30212974, 31736063, 9712416		★☆☆☆☆ Found in Text Mining only
Malignant Uterine Corpus Neoplasm	Malignant Uterine Corpus Neoplasm	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21638049, 28114269		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10205169, 10383144, 12853564, 17145873, 17465220, 20661224, 21939528, 22461506, 23749689, 23959396, 23999432, 24519943, 25249538, 25983297, 26181203, 26261492, 27035903, 27185877, 30367623		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12853564, 15704104, 18625725, 18632642, 18985033		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21638049, 28114269		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21638049, 28114269		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14632199, 16946712, 18507044, 18698037, 21521745, 23543055, 23890105, 26206558, 26269601, 26967479	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18398842, 18698037		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18507044, 19659570, 22045652, 22142822, 22856597, 24366194, 26194695, 26206558, 26208478, 26967479, 28060735, 29221137, 29550398, 29674508, 30115691		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35420772	Associate	★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere disease	Pubtator	38254912	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	15148612, 31400925		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	22989054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22989054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	18507044		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28223167		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	31752449	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	26208478, 31557826		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	18507044	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	14647450		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27246973	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29503661		★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes, Congenital	Myasthenic Syndrome	BEFREE	29700358		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28162790		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	29346494	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	26320593, 29059433		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	26595521		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	CTD_human_DG	24952746		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32277654	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nausea	Nausea	Pubtator	27074567	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10205169, 10782893, 11106235, 11123321, 12866037, 14503808, 15688028, 15782071, 15860267, 16061682, 16168116, 16675564, 17163417, 17266032, 17292332, 17661082, 18172732, 18507044, 18768436, 19150934, 19293185, 19401448, 19447869, 19622585, 19659570, 19737968, 19839716, 20179223, 20227043, 20467331, 20628057, 20816829, 21212430, 21364580, 21407808, 21482676, 21725367, 22067729, 22213458, 22461506, 22553357, 22873759, 23100016, 23233650, 23395887, 23468880, 23541807, 23575268, 23633485, 23835063, 23998444, 23999432, 24084886, 24300455, 24302555, 24519943, 25026212, 25238142, 25248370, 25451255, 25455899, 25519010, 25542901, 25596284, 25630670, 25739551, 25849870, 25983297, 26116360, 26148232, 26181203, 26194695, 26195293, 26206558, 26261492, 26367378, 26619359, 26844548, 26880266, 26926684, 26935861, 27070783, 27130196, 27191720, 27196778, 27269942, 27345413, 27514687, 27609096, 27986750, 28036286, 28123607, 28360206, 28388586, 28421882, 28448604, 28507002, 28592615, 28680745, 28733442, 28733706, 28821767, 28900130, 28961833, 28963699, 28978022, 29075780, 29288681, 29305574, 29440171, 29556616, 29763625, 29935372, 29948640, 29959202, 29967248, 29995421, 30068375, 30092835, 30115691, 30131447, 30173251, 30212974, 30259607, 30314301, 30367623, 30621788, 30679757, 30726523, 30733323, 30882895, 30915908, 30927244, 31043683, 31092882, 31308059, 31351986, 31395690, 31426807, 31443721, 31471314, 31484705, 31531954, 31619200, 31803175, 31850207, 7760096, 8464905, 8669836, 8834768, 8838364, 8943688, 9494565, 9499191, 9712416, 9788438, 9823984		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CLINVAR_DG	23680147		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23135478		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23135478, 36037157	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	15255999	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	BEFREE	17701898		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11153605, 15665299, 16288303, 16843264, 17442448, 17631905, 19150934, 19276677, 22485250, 23998444, 24646054, 25117641, 25891541, 25993617, 26137564, 26689995, 26862736, 28144730, 30302022, 30593826, 31092882, 31359792		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	LHGDN	17631905		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	9823984		★☆☆☆☆ Found in Text Mining only
Nystagmus Pathologic	Nystagmus	Pubtator	31752936	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21396094, 21939528		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33021861	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33021861	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15026342, 23541807, 31663373		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24854843	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	27913862, 9681822		★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10961689, 19737968, 20227043, 21364581, 25026212, 27913862, 29286064, 30588099, 30949858, 31328457, 31728045		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22841590, 23437196, 24901400, 26205780, 26770651, 28248115, 29286064, 29556616, 31328457, 31836588, 32029900, 35761259, 7710941	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	1361525, 17457047, 19304440, 20647770, 20726858, 22067729, 26109364, 27871278, 29549161, 29935372, 30882895, 30961642		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	11102889		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10615931, 17457047, 20726858, 25564668, 26109364, 27871278, 31911180, 34321959	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19304440	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25922907		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	26194695		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22086177		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23918833		★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	BEFREE	29350067		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	26245339		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	16896310, 19017278		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	29205961		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWASDB_DG	22885925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26416764		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26416764, 33664499	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWASCAT_DG	30566500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	BEFREE	26320593		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	19401448		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	26245339		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	18829572	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15141384, 16675564, 18490922, 18852121, 20587519, 27191720		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	16401639		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16675564, 17634423, 17638862, 18559590, 18852121		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17634423		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17634423, 17823122, 20159994, 20231295, 20574155, 22684500, 25876877, 34785213, 36095024, 36462326, 37380074	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	35594935	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	15731393		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20824716		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15360049		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	31433065		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	17604597	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	23227212		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23227212	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	23227212	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25530448		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Clear Cell	Sarcoma	Pubtator	16867224, 36959380	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15162166, 15334603, 16958035, 17092693, 17275115, 17485733, 18470533, 19995212, 28646138		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15162166, 16958035		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16958035, 17275115, 19995212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	25520391, 28582279, 29506988, 30131447		★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	18507044, 26194695		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18172732, 18507044, 19691460, 23468880, 23998444, 26194695, 26835877, 31320402, 9499191		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28899363, 29729836		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	14595263, 21801427, 26138066, 26195293, 28723928, 28939847, 29440293, 29792310, 32381551, 32452220, 34001187, 34167951, 34579737, 35756403	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	26195293, 29440293		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15476268, 16818711, 23468880, 27358485, 28723928, 28910149, 28939847, 29305574, 29413684, 29792310, 30694565, 31235758, 31308059, 31570699, 9494565		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	19691460		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12618754, 23445612, 25400108, 25455899, 26942872, 27787520, 28399526, 28899363, 28924391, 29233126, 30621788, 30726523, 30915908, 31484705		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18381441, 19047113		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23372746, 23680147, 24817940, 25455899, 26287187, 26844548, 28522256, 30621788, 30915908, 31781598, 32641744, 33374770, 35962301, 36916290	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CLINVAR_DG	23680147		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37537191	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25922907, 26735176, 28469731	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18424286		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35045748, 38144565	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23908177, 27663569, 30092835, 30367623		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26806567, 31792349, 32080212, 32558176	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30367623	Inhibit	★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	16469638		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	22989054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	22989054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15583696, 27906180, 31393349, 35035776, 35501832, 36818940	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	26287187, 28889394		★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18629779, 28112728, 34011535, 35581263	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	29254887	Associate	★☆☆☆☆ Found in Text Mining only