Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2049
Gene name	EPH receptor B3
Gene symbol	EPHB3
Synonyms (NCBI Gene)	EK2ETK2HEK2TYRO6
Chromosome	3
Chromosome location	3q27.1
Summary	Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to

190

Show/Hide all (190)

miRTarBase ID	miRNA	Experiments	Reference
MIRT542122	hsa-miR-8485	HITS-CLIP	19536157
MIRT542121	hsa-miR-603	HITS-CLIP	19536157
MIRT542120	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT542119	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT542121	hsa-miR-603	HITS-CLIP	19536157
MIRT542120	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT626271	hsa-miR-518c-5p	HITS-CLIP	19536157
MIRT626270	hsa-miR-326	HITS-CLIP	19536157
MIRT626269	hsa-miR-330-5p	HITS-CLIP	19536157
MIRT626268	hsa-miR-6764-3p	HITS-CLIP	19536157
MIRT626267	hsa-miR-6824-3p	HITS-CLIP	19536157
MIRT542119	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT626266	hsa-miR-3191-5p	HITS-CLIP	19536157
MIRT542122	hsa-miR-8485	HITS-CLIP	21572407
MIRT542121	hsa-miR-603	HITS-CLIP	21572407
MIRT542120	hsa-miR-342-3p	HITS-CLIP	21572407
MIRT542119	hsa-miR-377-3p	HITS-CLIP	21572407
MIRT542122	hsa-miR-8485	HITS-CLIP	23313552
MIRT542121	hsa-miR-603	HITS-CLIP	23313552
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23313552
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23313552
MIRT542122	hsa-miR-8485	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT542122	hsa-miR-8485	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT626271	hsa-miR-518c-5p	HITS-CLIP	23824327
MIRT626270	hsa-miR-326	HITS-CLIP	23824327
MIRT626269	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT626268	hsa-miR-6764-3p	HITS-CLIP	23824327
MIRT626267	hsa-miR-6824-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT626266	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT542122	hsa-miR-8485	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT626271	hsa-miR-518c-5p	HITS-CLIP	23824327
MIRT626270	hsa-miR-326	HITS-CLIP	23824327
MIRT626269	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT626268	hsa-miR-6764-3p	HITS-CLIP	23824327
MIRT626267	hsa-miR-6824-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT626266	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT542122	hsa-miR-8485	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT542122	hsa-miR-8485	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT626271	hsa-miR-518c-5p	HITS-CLIP	23824327
MIRT626270	hsa-miR-326	HITS-CLIP	23824327
MIRT626269	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT626268	hsa-miR-6764-3p	HITS-CLIP	23824327
MIRT626267	hsa-miR-6824-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT626266	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT542122	hsa-miR-8485	PAR-CLIP	21572407
MIRT542121	hsa-miR-603	PAR-CLIP	21572407
MIRT542120	hsa-miR-342-3p	PAR-CLIP	21572407
MIRT542119	hsa-miR-377-3p	PAR-CLIP	21572407
MIRT542120	hsa-miR-342-3p	HITS-CLIP	27418678
MIRT542119	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT542121	hsa-miR-603	HITS-CLIP	27418678
MIRT542122	hsa-miR-8485	HITS-CLIP	19536157
MIRT542121	hsa-miR-603	HITS-CLIP	19536157
MIRT542120	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT542119	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT542121	hsa-miR-603	HITS-CLIP	19536157
MIRT542120	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT626271	hsa-miR-518c-5p	HITS-CLIP	19536157
MIRT626270	hsa-miR-326	HITS-CLIP	19536157
MIRT626269	hsa-miR-330-5p	HITS-CLIP	19536157
MIRT626268	hsa-miR-6764-3p	HITS-CLIP	19536157
MIRT626267	hsa-miR-6824-3p	HITS-CLIP	19536157
MIRT542119	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT626266	hsa-miR-3191-5p	HITS-CLIP	19536157
MIRT542122	hsa-miR-8485	HITS-CLIP	21572407
MIRT542121	hsa-miR-603	HITS-CLIP	21572407
MIRT542120	hsa-miR-342-3p	HITS-CLIP	21572407
MIRT542119	hsa-miR-377-3p	HITS-CLIP	21572407
MIRT542122	hsa-miR-8485	HITS-CLIP	23313552
MIRT542121	hsa-miR-603	HITS-CLIP	23313552
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23313552
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23313552
MIRT542122	hsa-miR-8485	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT542122	hsa-miR-8485	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT626271	hsa-miR-518c-5p	HITS-CLIP	23824327
MIRT626270	hsa-miR-326	HITS-CLIP	23824327
MIRT626269	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT626268	hsa-miR-6764-3p	HITS-CLIP	23824327
MIRT626267	hsa-miR-6824-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT626266	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT542122	hsa-miR-8485	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT626271	hsa-miR-518c-5p	HITS-CLIP	23824327
MIRT626270	hsa-miR-326	HITS-CLIP	23824327
MIRT626269	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT626268	hsa-miR-6764-3p	HITS-CLIP	23824327
MIRT626267	hsa-miR-6824-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT626266	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT542122	hsa-miR-8485	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT542122	hsa-miR-8485	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT626271	hsa-miR-518c-5p	HITS-CLIP	23824327
MIRT626270	hsa-miR-326	HITS-CLIP	23824327
MIRT626269	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT626268	hsa-miR-6764-3p	HITS-CLIP	23824327
MIRT626267	hsa-miR-6824-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT626266	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT542121	hsa-miR-603	HITS-CLIP	23824327
MIRT542120	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT542119	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT542122	hsa-miR-8485	PAR-CLIP	21572407
MIRT542121	hsa-miR-603	PAR-CLIP	21572407
MIRT542120	hsa-miR-342-3p	PAR-CLIP	21572407
MIRT542119	hsa-miR-377-3p	PAR-CLIP	21572407
MIRT966703	hsa-miR-1254	CLIP-seq
MIRT966704	hsa-miR-137	CLIP-seq
MIRT966705	hsa-miR-1825	CLIP-seq
MIRT966706	hsa-miR-1972	CLIP-seq
MIRT966707	hsa-miR-3116	CLIP-seq
MIRT966708	hsa-miR-3177-3p	CLIP-seq
MIRT966709	hsa-miR-324-5p	CLIP-seq
MIRT966710	hsa-miR-377	CLIP-seq
MIRT966711	hsa-miR-4254	CLIP-seq
MIRT966712	hsa-miR-4434	CLIP-seq
MIRT966713	hsa-miR-4516	CLIP-seq
MIRT966714	hsa-miR-4531	CLIP-seq
MIRT966715	hsa-miR-4642	CLIP-seq
MIRT966716	hsa-miR-4650-5p	CLIP-seq
MIRT966717	hsa-miR-4778-5p	CLIP-seq
MIRT966718	hsa-miR-626	CLIP-seq
MIRT1548390	hsa-miR-4722-3p	CLIP-seq
MIRT1548391	hsa-miR-4755-3p	CLIP-seq
MIRT966710	hsa-miR-377	CLIP-seq
MIRT966710	hsa-miR-377	CLIP-seq
MIRT2220914	hsa-miR-1193	CLIP-seq
MIRT2220915	hsa-miR-1343	CLIP-seq
MIRT2220916	hsa-miR-149	CLIP-seq
MIRT2220917	hsa-miR-1914	CLIP-seq
MIRT2220918	hsa-miR-19a	CLIP-seq
MIRT2220919	hsa-miR-19b	CLIP-seq
MIRT2220920	hsa-miR-2392	CLIP-seq
MIRT2220921	hsa-miR-23a	CLIP-seq
MIRT2220922	hsa-miR-23b	CLIP-seq
MIRT2220923	hsa-miR-23c	CLIP-seq
MIRT2220924	hsa-miR-3064-5p	CLIP-seq
MIRT2220925	hsa-miR-320e	CLIP-seq
MIRT2220926	hsa-miR-323-5p	CLIP-seq
MIRT2220927	hsa-miR-339-5p	CLIP-seq
MIRT2220928	hsa-miR-3689d	CLIP-seq
MIRT966710	hsa-miR-377	CLIP-seq
MIRT2220929	hsa-miR-3921	CLIP-seq
MIRT2220930	hsa-miR-4251	CLIP-seq
MIRT2220931	hsa-miR-4329	CLIP-seq
MIRT966712	hsa-miR-4434	CLIP-seq
MIRT966713	hsa-miR-4516	CLIP-seq
MIRT2220932	hsa-miR-4653-5p	CLIP-seq
MIRT2220933	hsa-miR-4794	CLIP-seq
MIRT2220934	hsa-miR-491-5p	CLIP-seq
MIRT2220935	hsa-miR-597	CLIP-seq
MIRT2220936	hsa-miR-605	CLIP-seq
MIRT2220937	hsa-miR-760	CLIP-seq
MIRT2220938	hsa-miR-876-3p	CLIP-seq
MIRT966710	hsa-miR-377	CLIP-seq

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	ISS
GO:0001655	Process	Urogenital system development	IEA
GO:0001655	Process	Urogenital system development	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005003	Function	Ephrin receptor activity	IDA	8397371, 15536074
GO:0005003	Function	Ephrin receptor activity	IEA
GO:0005005	Function	Transmembrane-ephrin receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8397371, 15536074
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	IEA
GO:0007411	Process	Axon guidance	ISS
GO:0007413	Process	Axonal fasciculation	IEA
GO:0007413	Process	Axonal fasciculation	ISS
GO:0008046	Function	Axon guidance receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IDA	15536074
GO:0016477	Process	Cell migration	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0021952	Process	Central nervous system projection neuron axonogenesis	IEA
GO:0022038	Process	Corpus callosum development	IEA
GO:0022038	Process	Corpus callosum development	ISS
GO:0022407	Process	Regulation of cell-cell adhesion	IDA	8397371
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0031290	Process	Retinal ganglion cell axon guidance	IEA
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IDA	15536074
GO:0042995	Component	Cell projection	IEA
GO:0043087	Process	Regulation of GTPase activity	IDA	15536074
GO:0046777	Process	Protein autophosphorylation	IDA	8397371, 15536074
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	8397371, 15536074
GO:0048538	Process	Thymus development	IEA
GO:0048538	Process	Thymus development	ISS
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048546	Process	Digestive tract morphogenesis	ISS
GO:0050770	Process	Regulation of axonogenesis	IEA
GO:0050770	Process	Regulation of axonogenesis	ISS
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0051965	Process	Positive regulation of synapse assembly	ISS
GO:0060021	Process	Roof of mouth development	IEA
GO:0060021	Process	Roof of mouth development	ISS
GO:0060996	Process	Dendritic spine development	IEA
GO:0060996	Process	Dendritic spine development	ISS
GO:0060997	Process	Dendritic spine morphogenesis	IEA
GO:0060997	Process	Dendritic spine morphogenesis	ISS

MIM	HGNC	e!Ensembl
601839	3394	ENSG00000182580

P54753

Protein name

Ephrin type-B receptor 3 (EC 2.7.10.1) (EPH-like tyrosine kinase 2) (EPH-like kinase 2) (Embryonic kinase 2) (EK2) (hEK2) (Tyrosine-protein kinase TYRO6)

Protein function

Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is

PDB

3P1I , 3ZFY , 5L6O , 5L6P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01404	Ephrin_lbd	40 → 212	Ephrin receptor ligand binding domain	Domain
PF07699	Ephrin_rec_like	277 → 320	Putative ephrin-receptor like	Family
PF00041	fn3	341 → 437	Fibronectin type III domain	Domain
PF00041	fn3	454 → 535	Fibronectin type III domain	Domain
PF14575	EphA2_TM	560 → 630	Ephrin type-A receptor 2 transmembrane domain	Domain
PF07714	PK_Tyr_Ser-Thr	633 → 892	Protein tyrosine and serine/threonine kinase	Domain
PF00536	SAM_1	923 → 987	SAM domain (Sterile alpha motif)	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPES
GWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIP
NIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRS
FGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGT
CIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWS
EPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPN
GVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEF
ETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQY
IAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREV
FVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALD
SFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLS
RFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAA
SLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQM
TAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV

Sequence length

998

Interactions

View interactions

	KEGG		Reactome
	Axon guidance		EPH-Ephrin signaling EPHB-mediated forward signaling Ephrin signaling EPH-ephrin mediated repulsion of cells

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	18085615, 24707046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18085615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	28193203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31289549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21393996, 28120491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19607727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37535606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11920461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12408869, 17906625, 21266352, 24707046, 25277775, 27333864, 30535864, 31149041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21352556, 21393996, 30535864, 37535606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	16440290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	29970482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36944699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30535864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31289549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18281782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31807514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29789713, 30044964, 30408551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21266352, 28120491, 30503499, 31159225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18281782, 21266352, 25277775, 27333864, 27986811, 28120491, 28370854, 29789713, 29970482, 30408551, 30535864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular fasciitis	Nodular Fasciitis	BEFREE	16440290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21266352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31807514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27986811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19607727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	19607727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29970482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29789713, 30044964, 30408551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35027539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27986811	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27472710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	16681403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34296545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	37466160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EPHB3 (EPH receptor B3)