EPHA8 (EPH receptor A8)

Gene

• Entrez ID: 2046
• Gene name: EPH receptor A8
• Gene symbol: EPHA8
• Synonyms (NCBI Gene): EEK, EK3, HEK3
• Chromosome: 1
• Chromosome location: 1p36.12
• Summary: This gene encodes a member of the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typ

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT734812	hsa-miR-10a-3p	Microarray	33530159
MIRT966625	hsa-miR-1298	CLIP-seq
MIRT966626	hsa-miR-378g	CLIP-seq
MIRT966627	hsa-miR-4731-5p	CLIP-seq
MIRT966628	hsa-miR-764	CLIP-seq
MIRT966629	hsa-miR-1249	CLIP-seq
MIRT966630	hsa-miR-3150a-3p	CLIP-seq
MIRT966631	hsa-miR-3175	CLIP-seq
MIRT966632	hsa-miR-3184	CLIP-seq
MIRT966633	hsa-miR-361-3p	CLIP-seq
MIRT966634	hsa-miR-3675-5p	CLIP-seq
MIRT966635	hsa-miR-423-5p	CLIP-seq
MIRT966636	hsa-miR-4284	CLIP-seq
MIRT966637	hsa-miR-4302	CLIP-seq
MIRT966638	hsa-miR-4417	CLIP-seq
MIRT966639	hsa-miR-4437	CLIP-seq
MIRT966640	hsa-miR-4476	CLIP-seq
MIRT966641	hsa-miR-450b-5p	CLIP-seq
MIRT966642	hsa-miR-4514	CLIP-seq
MIRT966643	hsa-miR-4645-5p	CLIP-seq
MIRT966644	hsa-miR-4651	CLIP-seq
MIRT966645	hsa-miR-4673	CLIP-seq
MIRT966646	hsa-miR-4674	CLIP-seq
MIRT966647	hsa-miR-4685-5p	CLIP-seq
MIRT966648	hsa-miR-4692	CLIP-seq
MIRT966649	hsa-miR-4697-3p	CLIP-seq
MIRT966650	hsa-miR-4716-5p	CLIP-seq
MIRT966651	hsa-miR-4723-5p	CLIP-seq
MIRT966652	hsa-miR-4728-5p	CLIP-seq
MIRT966653	hsa-miR-4738-5p	CLIP-seq
MIRT966654	hsa-miR-4794	CLIP-seq
MIRT966655	hsa-miR-486-3p	CLIP-seq
MIRT966656	hsa-miR-507	CLIP-seq
MIRT966657	hsa-miR-541	CLIP-seq
MIRT966658	hsa-miR-557	CLIP-seq
MIRT966659	hsa-miR-587	CLIP-seq
MIRT966660	hsa-miR-591	CLIP-seq
MIRT966661	hsa-miR-608	CLIP-seq
MIRT966662	hsa-miR-617	CLIP-seq
MIRT966663	hsa-miR-654-5p	CLIP-seq
MIRT966664	hsa-miR-939	CLIP-seq
MIRT966633	hsa-miR-361-3p	CLIP-seq
MIRT1986302	hsa-miR-4419a	CLIP-seq
MIRT1986303	hsa-miR-4436b-3p	CLIP-seq
MIRT1986304	hsa-miR-4459	CLIP-seq
MIRT1986305	hsa-miR-4510	CLIP-seq
MIRT1986306	hsa-miR-4661-3p	CLIP-seq
MIRT1986307	hsa-miR-4722-5p	CLIP-seq
MIRT1986308	hsa-miR-4779	CLIP-seq
MIRT966642	hsa-miR-4514	CLIP-seq
MIRT966643	hsa-miR-4645-5p	CLIP-seq
MIRT966645	hsa-miR-4673	CLIP-seq
MIRT966648	hsa-miR-4692	CLIP-seq
MIRT2387487	hsa-miR-218	CLIP-seq
MIRT2387488	hsa-miR-455-5p	CLIP-seq
MIRT2387489	hsa-miR-4709-3p	CLIP-seq
MIRT2387490	hsa-miR-636	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005003	Function	Ephrin receptor activity	IEA
GO:0005003	Function	Ephrin receptor activity	ISS
GO:0005004	Function	GPI-linked ephrin receptor activity	IEA
GO:0005004	Function	GPI-linked ephrin receptor activity	ISS
GO:0005005	Function	Transmembrane-ephrin receptor activity	IBA
GO:0005524	Function	ATP binding	IEA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006929	Process	Substrate-dependent cell migration	IEA
GO:0006929	Process	Substrate-dependent cell migration	ISS
GO:0007155	Process	Cell adhesion	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	IEA
GO:0007411	Process	Axon guidance	ISS
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016322	Process	Neuron remodeling	IEA
GO:0016322	Process	Neuron remodeling	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0019838	Function	Growth factor binding	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030155	Process	Regulation of cell adhesion	ISS
GO:0030425	Component	Dendrite	IBA
GO:0031175	Process	Neuron projection development	IEA
GO:0031175	Process	Neuron projection development	ISS
GO:0031901	Component	Early endosome membrane	IEA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IEA
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0071372	Process	Cellular response to follicle-stimulating hormone stimulus	IEA

Other IDs

• MIM: 176945
• HGNC: 3391
• e!Ensembl: ENSG00000070886

Protein

• UniProt ID: P29322
• Protein name: Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK)
• Protein function: Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is
• PDB: 1UCV, 1X5L, 3KUL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01404	Ephrin_lbd	32 → 204	Ephrin receptor ligand binding domain	Domain
  PF00041	fn3	330 → 424	Fibronectin type III domain	Domain
  PF00041	fn3	438 → 524	Fibronectin type III domain	Domain
  PF14575	EphA2_TM	542 → 632	Ephrin type-A receptor 2 transmembrane domain	Domain
  PF07714	PK_Tyr_Ser-Thr	635 → 892	Protein tyrosine and serine/threonine kinase	Domain
  PF00536	SAM_1	932 → 992	SAM domain (Sterile alpha motif)	Domain

• Sequence:

  MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
  DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
  TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRG
  FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
  DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
  APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
  TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
  LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEK
  DKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDT
  RTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHP
  PGKLPEPQFYAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQR
  DVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGS
  LDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFG
  LSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW
  NMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE
  SLRATATVSRCPPPAFVRSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLG
  MVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL

• Sequence length: 1005

Pathways

KEGG:

Axon guidance

Reactome:

EPH-Ephrin signaling
EPHA-mediated growth cone collapse
EPH-ephrin mediated repulsion of cells

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High myopia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23699534		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	11698299	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	7905605		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19151749	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19435818	Associate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	8013627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26989075	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33213062	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27590381	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14726470		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16455651, 19051325		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35216506	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	11166921		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	23479771	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	14726470		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25683004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	25683004	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Diseases	Hematologic disease	Pubtator	31023863	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	25092868	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22390814	Associate	★☆☆☆☆ Found in Text Mining only
Infiltrating duct carcinoma of female breast	Infiltrating Duct Carcinoma Of Female Breast	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23860658	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28727840	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	2284097		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28465216		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31026069		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19940159, 23316053, 23699534		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14726470		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25258252	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33530159	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18794796, 23316053, 29284153, 29507701		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18657378, 19051325, 2555699, 30300334		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	27582484	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33213062	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30300334		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30300334	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22576800		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30300334		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31026069		★☆☆☆☆ Found in Text Mining only