EPHA7 (EPH receptor A7)

Gene

• Entrez ID: 2045
• Gene name: EPH receptor A7
• Gene symbol: EPHA7
• Synonyms (NCBI Gene): EHK-3, EHK3, EK11, HEK11
• Chromosome: 6
• Chromosome location: 6q16.1
• Summary: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically ha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT026092	hsa-miR-196a-5p	Sequencing	20371350
MIRT028172	hsa-miR-93-5p	Sequencing	20371350
MIRT049149	hsa-miR-92a-3p	CLASH	23622248
MIRT045990	hsa-miR-125b-5p	CLASH	23622248
MIRT043415	hsa-miR-331-3p	CLASH	23622248
MIRT039849	hsa-miR-615-3p	CLASH	23622248
MIRT037905	hsa-miR-455-3p	CLASH	23622248
MIRT548308	hsa-miR-200a-3p	PAR-CLIP	21572407
MIRT548307	hsa-miR-141-3p	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT318833	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT548306	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT548305	hsa-miR-577	PAR-CLIP	21572407
MIRT548304	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT548303	hsa-miR-4330	PAR-CLIP	21572407
MIRT548302	hsa-miR-3934-3p	PAR-CLIP	21572407
MIRT548301	hsa-miR-4760-5p	PAR-CLIP	21572407
MIRT548299	hsa-miR-8061	PAR-CLIP	21572407
MIRT548308	hsa-miR-200a-3p	PAR-CLIP	21572407
MIRT548307	hsa-miR-141-3p	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT318833	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT548306	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT548305	hsa-miR-577	PAR-CLIP	21572407
MIRT548304	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT548303	hsa-miR-4330	PAR-CLIP	21572407
MIRT548302	hsa-miR-3934-3p	PAR-CLIP	21572407
MIRT548300	hsa-miR-4775	PAR-CLIP	21572407
MIRT548301	hsa-miR-4760-5p	PAR-CLIP	21572407
MIRT548299	hsa-miR-8061	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT734801	hsa-miR-651-3p	RNA-seq	31540331
MIRT736191	hsa-miR-18a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33236144
MIRT548308	hsa-miR-200a-3p	PAR-CLIP	21572407
MIRT548307	hsa-miR-141-3p	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT318833	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT548306	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT548305	hsa-miR-577	PAR-CLIP	21572407
MIRT548304	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT548303	hsa-miR-4330	PAR-CLIP	21572407
MIRT548302	hsa-miR-3934-3p	PAR-CLIP	21572407
MIRT548301	hsa-miR-4760-5p	PAR-CLIP	21572407
MIRT548299	hsa-miR-8061	PAR-CLIP	21572407
MIRT548308	hsa-miR-200a-3p	PAR-CLIP	21572407
MIRT548307	hsa-miR-141-3p	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT318833	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT548306	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT548305	hsa-miR-577	PAR-CLIP	21572407
MIRT548304	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT548303	hsa-miR-4330	PAR-CLIP	21572407
MIRT548302	hsa-miR-3934-3p	PAR-CLIP	21572407
MIRT548300	hsa-miR-4775	PAR-CLIP	21572407
MIRT548301	hsa-miR-4760-5p	PAR-CLIP	21572407
MIRT548299	hsa-miR-8061	PAR-CLIP	21572407
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT101977	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT966614	hsa-miR-1299	CLIP-seq
MIRT966615	hsa-miR-203	CLIP-seq
MIRT966616	hsa-miR-4444	CLIP-seq
MIRT966617	hsa-miR-4477a	CLIP-seq
MIRT966618	hsa-miR-4705	CLIP-seq
MIRT966619	hsa-miR-4753-3p	CLIP-seq
MIRT966620	hsa-miR-4782-5p	CLIP-seq
MIRT966621	hsa-miR-496	CLIP-seq
MIRT966622	hsa-miR-516b	CLIP-seq
MIRT966623	hsa-miR-7	CLIP-seq
MIRT966624	hsa-miR-875-3p	CLIP-seq
MIRT1986292	hsa-miR-3074-3p	CLIP-seq
MIRT1986293	hsa-miR-3671	CLIP-seq
MIRT1986294	hsa-miR-412	CLIP-seq
MIRT1986295	hsa-miR-4255	CLIP-seq
MIRT1986296	hsa-miR-4302	CLIP-seq
MIRT1986297	hsa-miR-4310	CLIP-seq
MIRT1986298	hsa-miR-4711-5p	CLIP-seq
MIRT1986299	hsa-miR-4719	CLIP-seq
MIRT1986300	hsa-miR-513b	CLIP-seq
MIRT1986301	hsa-miR-578	CLIP-seq
MIRT2220875	hsa-miR-103a	CLIP-seq
MIRT2220876	hsa-miR-107	CLIP-seq
MIRT2220877	hsa-miR-125a-5p	CLIP-seq
MIRT2220878	hsa-miR-125b	CLIP-seq
MIRT2220879	hsa-miR-1278	CLIP-seq
MIRT2220880	hsa-miR-30a	CLIP-seq
MIRT2220881	hsa-miR-30b	CLIP-seq
MIRT2220882	hsa-miR-30c	CLIP-seq
MIRT2220883	hsa-miR-30d	CLIP-seq
MIRT2220884	hsa-miR-30e	CLIP-seq
MIRT2220885	hsa-miR-3168	CLIP-seq
MIRT2220886	hsa-miR-320e	CLIP-seq
MIRT2220887	hsa-miR-325	CLIP-seq
MIRT2220888	hsa-miR-3545-3p	CLIP-seq
MIRT2220889	hsa-miR-3617	CLIP-seq
MIRT2220890	hsa-miR-3663-3p	CLIP-seq
MIRT2220891	hsa-miR-4266	CLIP-seq
MIRT2220892	hsa-miR-4277	CLIP-seq
MIRT2220893	hsa-miR-4311	CLIP-seq
MIRT2220894	hsa-miR-4319	CLIP-seq
MIRT2220895	hsa-miR-4490	CLIP-seq
MIRT2220896	hsa-miR-4503	CLIP-seq
MIRT2220897	hsa-miR-4724-5p	CLIP-seq
MIRT2220898	hsa-miR-4735-5p	CLIP-seq
MIRT2220899	hsa-miR-4795-3p	CLIP-seq
MIRT2220900	hsa-miR-4796-5p	CLIP-seq
MIRT2220901	hsa-miR-512-3p	CLIP-seq
MIRT2220902	hsa-miR-628-3p	CLIP-seq
MIRT2220903	hsa-miR-641	CLIP-seq
MIRT2524581	hsa-miR-1229	CLIP-seq
MIRT2524582	hsa-miR-342-3p	CLIP-seq
MIRT1986299	hsa-miR-4719	CLIP-seq
MIRT2524583	hsa-miR-4753-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	ISS
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005003	Function	Ephrin receptor activity	IEA
GO:0005004	Function	GPI-linked ephrin receptor activity	IEA
GO:0005004	Function	GPI-linked ephrin receptor activity	ISS
GO:0005005	Function	Transmembrane-ephrin receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	22036564, 33961781, 35384245
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16862074
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS
GO:0008046	Function	Axon guidance receptor activity	IEA
GO:0008046	Function	Axon guidance receptor activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016310	Process	Phosphorylation	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0019838	Function	Growth factor binding	IEA
GO:0022407	Process	Regulation of cell-cell adhesion	IEA
GO:0022407	Process	Regulation of cell-cell adhesion	ISS
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0031290	Process	Retinal ganglion cell axon guidance	IEA
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031952	Process	Regulation of protein autophosphorylation	ISS
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045499	Function	Chemorepellent activity	IEA
GO:0045499	Function	Chemorepellent activity	ISS
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	17726105
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048671	Process	Negative regulation of collateral sprouting	IEA
GO:0048755	Process	Branching morphogenesis of a nerve	IEA
GO:0048755	Process	Branching morphogenesis of a nerve	ISS
GO:0050730	Process	Regulation of peptidyl-tyrosine phosphorylation	IDA	17726105
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050919	Process	Negative chemotaxis	ISS
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051964	Process	Negative regulation of synapse assembly	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IDA	17726105
GO:0072178	Process	Nephric duct morphogenesis	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099175	Process	Regulation of postsynapse organization	IEA
GO:0099634	Component	Postsynaptic specialization membrane	IEA

Other IDs

• MIM: 602190
• HGNC: 3390
• e!Ensembl: ENSG00000135333

Protein

• UniProt ID: Q15375
• Protein name: Ephrin type-A receptor 7 (EC 2.7.10.1) (EPH homology kinase 3) (EHK-3) (EPH-like kinase 11) (EK11) (hEK11)
• Protein function: Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is
• PDB: 2REI, 3DKO, 3H8M, 3NRU, 7EEC, 7EED, 7EEF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01404	Ephrin_lbd	33 → 205	Ephrin receptor ligand binding domain	Domain
  PF00041	fn3	333 → 427	Fibronectin type III domain	Domain
  PF00041	fn3	444 → 527	Fibronectin type III domain	Domain
  PF14575	EphA2_TM	557 → 630	Ephrin type-A receptor 2 transmembrane domain	Domain
  PF07714	PK_Tyr_Ser-Thr	633 → 890	Protein tyrosine and serine/threonine kinase	Domain
  PF07647	SAM_2	920 → 985	SAM domain (Sterile alpha motif)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed.
• Sequence:

  MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISG
  LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
  ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
  GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
  EAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
  FSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
  NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG
  VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
  YEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATG
  KMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHF
  KFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDV
  AVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALD
  AFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLS
  RVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDM
  SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSL
  KTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTI
  EDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV

• Sequence length: 998

Pathways

KEGG:

Axon guidance

Reactome:

EPH-Ephrin signaling
EPHA-mediated growth cone collapse
EPH-ephrin mediated repulsion of cells

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC FATIGUE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METACHRONOUS COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PORTAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	17726105		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	26345456		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35390284	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	29904178	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	17260020, 26936314		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27566654		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21124932, 27195705, 27566654, 33977106	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22496620, 35103233	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18821581		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35103233	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	36736454	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	25968442		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23676193		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	19949912	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32843430, 39694330	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26261572		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	26345456		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	34382870	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16007213, 31505877		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16007213, 31505877		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20085586	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	29904178	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18366728		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18366728	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	29904178		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21124932, 27566654	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	17260020		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21454882	Associate	★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	25139858		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	31118261		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25968442	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	25968442		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17726105	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24022400	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22036564, 22114070, 22356769, 23676193		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	22036564, 27121112		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	25968442		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23676193		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26261572		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18821581, 29022918		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18821581, 22356769, 30670742, 31118261		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16007213, 31505877		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	26345456		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33236144	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	15779235	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17260020, 21124932, 22036564, 22114070, 22356769, 23676193, 26345456, 28604772, 29022918		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26936314		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28604772		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28604772	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26261572		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26261572, 28611294	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19949912	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30292674		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18821581, 29022918		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16042785	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29022918		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	CTD_human_DG	22941188		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24022400, 25612142, 25968442	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26769141	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid hormone resistance	Pubtator	27195705	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34396843	Associate	★☆☆☆☆ Found in Text Mining only
Ureterocele	Ureterocele	BEFREE	25139858		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35681118	Associate	★☆☆☆☆ Found in Text Mining only